Property Summary

NCBI Gene PubMed Count 20
Grant Count 1
Funding $6,387.5
PubMed Score 481.44
PubTator Score 14.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession Q7Z3Z4 B4DEG5 Q68CZ4 Q8N8G9 Q8N9V8 Q8NEH2
Symbols HIWI2
MIWI2

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (13)

PMID Text
26646899 Results show that three CpG loci within FYN were hypermethylated in obese individuals, while obesity was associated with lower methylation of CpG loci within PIWIL4 and TAOK3.
25038252 Immunoprecipitation of Hiwi2 from MDAMB231 cancer cells enriches for piRNAs that are predominantly derived from processed tRNAs and expressed genes.
24969058 study to evaluate frequency of PIWIL4 genetic variants in order to better define the relationship between PIWIL4 SNPs and defective spermatogenesis and specific spermatogenic disorders; results suggest genetic and epigenetic alterations that affect the PIWI pathway contribute to unsuccessful sperm production
24509249 associations were determined between the Piwi-like family member expression levels and clinicopathological parameters of ccRCC, suggesting a potential role for these genes/proteins in ccRCC diagnostics and tumorigenesis
24464225 Data suggest that MIWI2 and MIWI2-associated piRNAs have functions beyond TE suppression.
22748119 we identified a significant association between the expression of Piwi-like 2 and 4 mRNAs and the tumor-specific survival of soft tissue sarcoma patients.
22483988 PIWIL4 might play an oncogenic role in cervical cancer
20940137 An SNP in the 3'untranslated region of HIWI2 and a non-synonymous SNP in HIWI3 were significantly associated with an altered risk of oligozoospermia.
20940137 Observational study of gene-disease association. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFM      1 - 70
ERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQDWQLYQYHVTYIPDLASRRLR     71 - 140
IALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQRGETIKMTITLKRELPSSSPVCIQVFNIIF    141 - 210
RKILKKLSMYQIGRNFYNPSEPMEIPQHKLSLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTAL    211 - 280
CQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSD    281 - 350
LNQPMLVSLLKKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN    351 - 420
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILNAQSLNTWLIL    421 - 490
CSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCILPSNQKTYYD    491 - 560
SIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMTCKLGGELWAVEIPLKSLMVVGIDVCKDALS    561 - 630
KDVMVVGCVASVNPRITRWFSRCILQRTMTDVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQL    631 - 700
KTLIEYEVPQLLSSVAESSSNTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYL    701 - 770
ISQVACRGTVSPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE    771 - 840
PSLELANHLFYL                                                              841 - 852
//

Text Mined References (21)

PMID Year Title
26646899 2015 Genome-wide methylation analysis identifies differentially methylated CpG loci associated with severe obesity in childhood.
25038252 2014 The human Piwi protein Hiwi2 associates with tRNA-derived piRNAs in somatic cells.
24969058 Association of PIWIL4 genetic variants with germ cell maturation arrest in infertile Spanish men.
24509249 2014 Piwi-like 1 and 4 gene transcript levels are associated with clinicopathological parameters in renal cell carcinomas.
24464225 2014 Conditional inactivation of Miwi2 reveals that MIWI2 is only essential for prospermatogonial development in mice.
22748119 2012 Expression of human Piwi-like genes is associated with prognosis for soft tissue sarcoma patients.
22483988 2012 PIWIL4 regulates cervical cancer cell line growth and is involved in down-regulating the expression of p14ARF and p53.
20940137 2010 Genetic variants in Piwi-interacting RNA pathway genes confer susceptibility to spermatogenic failure in a Chinese population.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...