Property Summary

NCBI Gene PubMed Count 7
PubMed Score 72.65
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
18976975 Knockdown of notch 2 N-terminal like (NOTCH2NL) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPC      1 - 70
FVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKC     71 - 140
ETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCL    141 - 210
PETVRRGTELWERDREVWNGKEHDEN                                                211 - 236
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673143 2004 A novel notch protein, N2N, targeted by neutrophil elastase and implicated in hereditary neutropenia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.