Property Summary

NCBI Gene PubMed Count 9
PubMed Score 73.51
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Gene RIF (1)

AA Sequence

MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPC      1 - 70
FVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKC     71 - 140
ETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCL    141 - 210
PETVRRGTELWERDREVWNGKEHDEN                                                211 - 236
//

Text Mined References (12)

PMID Year Title