Property Summary

NCBI Gene PubMed Count 27
PubMed Score 8.51
PubTator Score 4.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Neurodevelopmental Disorders 70 0.0 0.0
WHITE-SUTTON SYNDROME 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Autism spectrum disorder 101 4.174 2.1

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.800 6.9e-03
cystic fibrosis and chronic rhinosinusit... 1.168 3.8e-02
ependymoma 2.100 3.4e-03
group 3 medulloblastoma 1.200 4.5e-02
intraductal papillary-mucinous adenoma (... 1.200 3.6e-03
oligodendroglioma 1.100 2.2e-03
osteosarcoma 1.799 5.2e-04
ovarian cancer -1.800 1.2e-08
pancreatic ductal adenocarcinoma liver m... 1.120 3.2e-03
Pick disease 1.500 5.9e-06

Gene RIF (9)

AA Sequence

MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVAGHLSTSTT      1 - 70
VSSSGAQNSDSTKKTLVTLIANNNAGNPLVQQGGQPLILTQNPAPGLGTMVTQPVLRPVQVMQNANHVTS     71 - 140
SPVASQPIFITTQGFPVRNVRPVQNAMNQVGIVLNVQQGQTVRPITLVPAPGTQFVKPTVGVPQVFSQMT    141 - 210
PVRPGSTMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPTSLGQLAVQSPGQSNQ    211 - 280
TTNPKLAPSFPSPPAVSIASFVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQSPGPVVVSNNSSAHGSQR    281 - 350
TSGPESSMKVTSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQKKGKSLDSEPSVPSA    351 - 420
AKPPSPEKTAPVASTPSSTPIPALSPPTKVPEPNENVGDAVQTKLIMLVDDFYYGRDGGKVAQLTNFPKV    421 - 490
ATSFRCPHCTKRLKNNIRFMNHMKHHVELDQQNGEVDGHTICQHCYRQFSTPFQLQCHLENVHSPYESTT    491 - 560
KCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKN    561 - 630
GNAFQQHYMRHQKRNVYHCNKCRLQFLFAKDKIEHKLQHHKTFRKPKQLEGLKPGTKVTIRASRGQPRTV    631 - 700
PVSSNDTPPSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTY    701 - 770
VHCSLCRYSTCCSRAYANHMINNHVPRKSPKYLALFKNSVSGIKLACTSCTFVTSVGDAMAKHLVFNPSH    771 - 840
RSSSILPRGLTWIAHSRHGQTRDRVHDRNVKNMYPPPSFPTNKAATVKSAGATPAEPEELLTPLAPALPS    841 - 910
PASTATPPPTPTHPQALALPPLATEGAECLNVDDQDEGSPVTQEPELASGGGGSGGVGKKEQLSVKKLRV    911 - 980
VLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAEWVLTQREQQLPVNEETL    981 - 1050
FQKATKIGRSLEGGFKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLS   1051 - 1120
MIVAIDEISLFLDTEVLSSDDRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDSI   1121 - 1190
LLEAKESGYSDDEIMELWSTRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSK   1191 - 1260
IQPLDVCIKRTVKNFLHKKWKEQAREMADTACDSDVLLQLVLVWLGEVLGVIGDCPELVQRSFLVASVLP   1261 - 1330
GPDGNINSPTRNADMQEELIASLEEQLKLSGEHSESSTPRPRSSPEETIEPESLHQLFEGESETESFYGF   1331 - 1400
EEADLDLMEI                                                               1401 - 1410
//

Text Mined References (39)

PMID Year Title