Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.72
PubTator Score 0.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.6e-07
malignant mesothelioma 3232 4.8e-07
ovarian cancer 8520 5.6e-06
tuberculosis 2010 1.5e-05
medulloblastoma, large-cell 6241 3.6e-05
colon cancer 1478 1.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Liver cancer 604 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer -1.300 1.5e-04
malignant mesothelioma -1.400 4.8e-07
medulloblastoma, large-cell -1.100 3.6e-05
osteosarcoma -1.712 1.6e-07
ovarian cancer -1.100 5.6e-06
tuberculosis 1.100 1.5e-05

Gene RIF (5)

AA Sequence

MAVFPWHSRNRNYKAEFASCRLEAVPLEFGDYHPLKPITVTESKTKKVNRKGSTSSTSSSSSSSVVDPLS      1 - 70
SVLDGTDPLSMFAATADPAALAAAMDSSRRKRDRDDNSVVGSDFEPWTNKRGEILARYTTTEKLSINLFM     71 - 140
GSEKGKAGTATLAMSEKVRTRLEELDDFEEGSQKELLNLTQQDYVNRIEELNQSLKDAWASDQKVKALKI    141 - 210
VIQCSKLLSDTSVIQFYPSKFVLITDILDTFGKLVYERIFSMCVDSRSVLPDHFSPENANDTAKETCLNW    211 - 280
FFKIASIRELIPRFYVEASILKCNKFLSKTGISECLPRLTCMIRGIGDPLVSVYARAYLCRVGMEVAPHL    281 - 350
KETLNKNFFDFLLTFKQIHGDTVQNQLVVQGVELPSYLPLYPPAMDWIFQCISYHAPEALLTEMMERCKK    351 - 420
LGNNALLLNSVMSAFRAEFIATRSMDFIGMIKECDESGFPKHLLFRSLGLNLALADPPESDRLQILNEAW    421 - 490
KVITKLKNPQDYINCAEVWVEYTCKHFTKREVNTVLADVIKHMTPDRAFEDSYPQLQLIIKKVIAHFHDF    491 - 560
SVLFSVEKFLPFLDMFQKESVRVEVCKCIMDAFIKHQQEPTKDPVILNALLHVCKTMHDSVNALTLEDEK    561 - 630
RMLSYLINGFIKMVSFGRDFEQQLSFYVESRSMFCNLEPVLVQLIHSVNRLAMETRKVMKGNHSRKTAAF    631 - 700
VRACVAYCFITIPSLAGIFTRLNLYLHSGQVALANQCLSQADAFFKAAISLVPEVPKMINIDGKMRPSES    701 - 770
FLLEFLCNFFSTLLIVPDHPEHGVLFLVRELLNVIQDYTWEDNSDEKIRIYTCVLHLLSAMSQETYLYHI    771 - 840
DKVDSNDSLYGGDSKFLAENNKLCETVMAQILEHLKTLAKDEALKRQSSLGLSFFNSILAHGDLRNNKLN    841 - 910
QLSVNLWHLAQRHGCADTRTMVKTLEYIKKQSKQPDMTHLTELALRLPLQTRT                     911 - 963
//

Text Mined References (17)

PMID Year Title