Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 4.9e-05
atypical teratoid / rhabdoid tumor 1.400 5.1e-09
ependymoma 1.200 4.4e-12
glioblastoma 1.100 1.4e-07
group 4 medulloblastoma 1.300 1.5e-06
medulloblastoma, large-cell 1.400 2.0e-04
primitive neuroectodermal tumor 1.500 5.2e-06

AA Sequence

MEQEKKLLVSDSNSFMERESLKSPFTGDTSMNNLETVHHNNSKADKLKEKPSEWSKRHRPQHYKHEDAKE      1 - 70
MPLTWVQDEIWCHDSYESDGKSENWGNFIAKEEEKPNHQEWDSGEHTNACVQQNSSFVDRPYKCSECWKS     71 - 140
FSNSSHLRTHQRTHSGEKPYKCSECAKCFCNSSHLIQHLRMHTGEKPYQCGECGKSFSNTSHLIIHERTH    141 - 210
TGEKPYKCPECGKRFSSSSHLIQHHRSHTGEKPYECSVCGKGFSHSYVLIEHQRTHTGEKPYKCPDCGKS    211 - 280
FSQSSSLIRHQRTHTGEKPYKCLECEKSFGCNSTLIKHQRIHTGEKPYQCPECGKNFSRSSNLITHQKMH    281 - 350
TGEKSYESSEYEESLGQNCNVIEECRIQLGEKPYRCCECGKSFGLSSHLIRHQRTHTGEKPYRCSECWKT    351 - 420
FSQSSTLVIHQRTHTGEKPYKCPDCGESFSQSFNLIRHRRTHIGEKPYKCTSCEKCFSRSAYLSQHRKIH    421 - 490
VEKPFESPDVGDFPHEWTWKNCSGEMPFISSFSVSNSSS                                   491 - 529
//

Text Mined References (13)

PMID Year Title