Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.64
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MKVQPSVTCVASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLLVPCLEEEELA      1 - 70
LHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQLQAILDGGVSPEEATQVDSNGRTGLMVACY     71 - 140
HGFQSVVALLSHCPFLDVNQQDKGGDTALMLAAQAGHVPLVSLLLNYYVGLDLERRDQRGLTALMKAAMR    141 - 210
NRCADLTAVDPVRGKTALEWAVLTDSFDTVWRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVA    211 - 280
PSLLERLQATLSLPFAPSPQEGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLGTAP    281 - 350
PPPLVPQSPPGSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSP    351 - 420
SGHQSLALPLWRYQELRIEKRKQEEEARMAQK                                          421 - 452
//

Text Mined References (7)

PMID Year Title