Property Summary

NCBI Gene PubMed Count 18
Grant Count 16
R01 Count 11
Funding $2,781,913.67
PubMed Score 264.87
PubTator Score 47.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.549 0.009
urothelial carcinoma -1.100 0.023
osteosarcoma 1.144 0.006
cystic fibrosis 1.349 0.000
medulloblastoma, large-cell -1.800 0.000
acute quadriplegic myopathy 1.376 0.000
adrenocortical carcinoma -3.039 0.000
tuberculosis -1.100 0.010
non-small cell lung cancer -1.113 0.000
Hydrolethalus syndrome 1.497 0.048
lung cancer -3.800 0.000
colon cancer -1.100 0.014
active ulcerative colitis 1.345 0.010
diabetes mellitus -1.400 0.038
group 4 medulloblastoma -1.200 0.002
lung adenocarcinoma -1.200 0.000
psoriasis -1.300 0.000
inflammatory breast cancer -1.700 0.000
lung carcinoma -1.500 0.000
spina bifida -1.387 0.040
acute myeloid leukemia 1.600 0.040
ovarian cancer 1.600 0.003
chronic rhinosinusitis -1.372 0.028
pancreatic cancer 1.100 0.039

Gene RIF (6)

PMID Text
26814197 these data identify a new mechanism of LXR regulation that involves TIPARP, ADP-ribosylation and MACROD1.
24806346 Knockdown of TiPARP, but not AHRR, increased 2,3,7,8-tetrachlorodibenzo-p-dioxin - induced CYP1A1 mRNA and AHR protein levels.
24162774 HIV-1 gp120 upregulates the expression of TCDD-inducible poly(ADP-ribose) polymerase (TIPARP) in human B cells
20852632 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852632 Single nucleotide polymorphism in TIPARP is associated with ovarian cancer.
12851707 TIPARP (DKFZp434J214) gene is amplified in HNSCC. TIPARP, FLJ22693 and ZAP proteins with TPH, WW and PARP-like domains constitute the TIPARP family.

AA Sequence

MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLD      1 - 70
GVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQIPEAHPSTEAPERVVPIQDH     71 - 140
SFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDKVIDYVPGIFQENSFTIQYILDTSDKLSTEL    141 - 210
FQDKSEEASLDLVFELVNQLQYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQS    211 - 280
VFNDSQEHLERFYCNPENDRMRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFF    281 - 350
CRDHFGWREYPESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG    351 - 420
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNLFHKTVPEFKY    421 - 490
RILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVDGICKHNFDPRVCGKHATMFG    491 - 560
QGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGSHGMRRPPPVNPGSVTSDLYDSCVDNFFEPQ    561 - 630
IFVIFNDDQSYPYFVIQYEEVSNTVSI                                               631 - 657
//

Text Mined References (20)

PMID Year Title
26814197 2016 TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.
24806346 2014 Aryl hydrocarbon receptor repressor and TiPARP (ARTD14) use similar, but also distinct mechanisms to repress aryl hydrocarbon receptor signaling.
23544013 2013 Genome-wide association study in BRCA1 mutation carriers identifies novel loci associated with breast and ovarian cancer risk.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23275542 2013 2,3,7,8-Tetrachlorodibenzo-p-dioxin poly(ADP-ribose) polymerase (TiPARP, ARTD14) is a mono-ADP-ribosyltransferase and repressor of aryl hydrocarbon receptor transactivation.
20852632 2010 A genome-wide association study identifies susceptibility loci for ovarian cancer at 2q31 and 8q24.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
18762178 2008 A human intervention study with foods containing natural Ah-receptor agonists does not significantly show AhR-mediated effects as measured in blood cells and urine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
More...