Property Summary

NCBI Gene PubMed Count 18
PubMed Score 285.19
PubTator Score 47.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
ovarian cancer 1.600 2.5e-03
active ulcerative colitis 1.345 9.7e-03
acute myeloid leukemia 1.600 4.0e-02
acute quadriplegic myopathy 1.376 2.3e-06
adrenocortical carcinoma -3.039 4.9e-12
Breast cancer -1.200 1.7e-07
chronic rhinosinusitis -1.372 2.8e-02
colon cancer -1.100 1.4e-02
cystic fibrosis 1.349 8.9e-06
diabetes mellitus -1.400 3.8e-02
group 4 medulloblastoma -1.200 2.4e-03
Hydrolethalus syndrome 1.497 4.8e-02
lung adenocarcinoma -1.200 7.1e-05
lung cancer -3.400 9.2e-06
lung carcinoma -1.500 4.9e-15
medulloblastoma, large-cell -1.800 2.4e-05
Multiple myeloma 1.549 8.7e-03
non-small cell lung cancer -1.113 1.2e-09
osteosarcoma 1.144 6.3e-03
pancreatic cancer 1.100 3.9e-02
psoriasis -1.100 3.7e-05
spina bifida -1.387 4.0e-02
tuberculosis -1.100 1.0e-02
urothelial carcinoma -1.100 2.3e-02

Protein-protein Interaction (4)

Gene RIF (6)

AA Sequence

MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLD      1 - 70
GVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQIPEAHPSTEAPERVVPIQDH     71 - 140
SFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDKVIDYVPGIFQENSFTIQYILDTSDKLSTEL    141 - 210
FQDKSEEASLDLVFELVNQLQYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQS    211 - 280
VFNDSQEHLERFYCNPENDRMRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFF    281 - 350
CRDHFGWREYPESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG    351 - 420
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNLFHKTVPEFKY    421 - 490
RILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVDGICKHNFDPRVCGKHATMFG    491 - 560
QGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGSHGMRRPPPVNPGSVTSDLYDSCVDNFFEPQ    561 - 630
IFVIFNDDQSYPYFVIQYEEVSNTVSI                                               631 - 657
//

Text Mined References (20)

PMID Year Title