Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.29
PubTator Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Tobacco Use Disorder 12 0.0 0.0

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.100 3.0e-03
ovarian cancer -2.000 9.9e-08
pancreatic ductal adenocarcinoma liver m... -1.487 3.1e-02
tuberculosis -1.400 1.1e-06

AA Sequence

MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQ      1 - 70
EGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQYSSE     71 - 140
QQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLNEVVSALTAQQMRFEPDNKNTQRKDPYY    141 - 210
GADWGIGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTK    211 - 280
GIHFSQQDDHKLYSQDSQSPAAQQET                                                281 - 306
//

Text Mined References (11)

PMID Year Title