Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.26
PubTator Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Tobacco Use Disorder 10
Disease Target Count P-value
ovarian cancer 8492 9.94469096576469E-8
tuberculosis 1563 1.08960664340347E-6
diabetes mellitus 1663 0.00296522250379465
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0313422642667905

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.487 0.031
tuberculosis -1.400 0.000
diabetes mellitus -1.100 0.003
ovarian cancer -2.000 0.000

Synonym

Accession Q7Z3D4 Q5H9U0 Q6PEK0 Q9NTE9
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

AA Sequence

MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQ      1 - 70
EGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQYSSE     71 - 140
QQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRENLNEVVSALTAQQMRFEPDNKNTQRKDPYY    141 - 210
GADWGIGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTK    211 - 280
GIHFSQQDDHKLYSQDSQSPAAQQET                                                281 - 306
//

Text Mined References (11)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...