Property Summary

NCBI Gene PubMed Count 52
PubMed Score 78.20
PubTator Score 35.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.620 2.7e-09
adult high grade glioma -1.800 2.5e-03
aldosterone-producing adenoma -1.035 2.0e-02
astrocytic glioma -1.800 5.4e-04
Astrocytoma, Pilocytic -1.300 1.1e-02
Atopic dermatitis -2.400 8.6e-04
atypical teratoid / rhabdoid tumor -2.200 3.4e-05
cystic fibrosis -1.012 7.6e-03
ductal carcinoma in situ -1.700 1.6e-02
ependymoma -1.500 7.8e-03
glioblastoma -1.900 3.9e-05
group 3 medulloblastoma -1.900 2.5e-02
head and neck cancer -2.100 6.7e-03
intraductal papillary-mucinous adenoma (... -2.100 1.6e-02
intraductal papillary-mucinous carcinoma... -2.700 9.5e-03
intraductal papillary-mucinous neoplasm ... -2.900 2.3e-02
invasive ductal carcinoma -2.600 5.4e-03
lung adenocarcinoma -1.200 6.6e-14
medulloblastoma, large-cell -3.600 1.6e-03
non-small cell lung cancer -1.582 7.2e-16
oligodendroglioma -1.600 7.4e-03
ovarian cancer -2.400 2.2e-16
Pick disease -1.600 1.3e-03
pituitary cancer 1.500 3.3e-03
primitive neuroectodermal tumor -1.200 4.2e-02
psoriasis -1.100 6.6e-14

Protein-protein Interaction (2)

Gene RIF (34)

AA Sequence

MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGA      1 - 70
WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPK     71 - 140
IYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVS    141 - 210
FPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRS    211 - 280
ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKN    281 - 350
AILQ                                                                      351 - 354
//

Text Mined References (54)

PMID Year Title