Property Summary

NCBI Gene PubMed Count 49
Grant Count 3
Funding $211,183.5
PubMed Score 129.11
PubTator Score 35.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z3B1 Q5VT21 Q6UY06 Q8N440 Q8NAQ3
Symbols Ntra
KILON
IGLON4
DMML2433

Gene

PANTHER Protein Class (1)

Gene RIF (31)

PMID Text
25640768 Genetic variants associated with BMI and WHR in adults influence growth patterns and general and abdominal fat development from early childhood onwards.
25370040 We observed novel selection signals in CDKAL1 and NEGR1, well-known diabetes and obesity susceptibility genes
25245582 NEGR1 could be an important locus influencing certain personality dimensions in BN patients.
25072390 First study to find an association between an obesity risk gene and differences in white matter integrity. As our subjects were young and healthy, our results suggest that NEGR1 has effects on brain structure independent of its effect on obesity.
23950990 Data indicate strong associations with severe obesity for single nucleotide polymorphism (SNP) rs9939609 within the FTO gene and SNP rs2815752 near the NEGR1 gene.
23229156 Results imply a regulatory role for TMEM18, BDNF, MTCH2 and NEGR1 in adipocyte differentiation and biology. In addition, we show a variation of MAF expression during adipogenesis, while NPC1, PTER and SH2B1 were not regulated.
22443470 Our study supports earlier reports of SH2B1 to be of importance in insulin sensitivity and, in addition, suggests potential roles of NEGR1 and MTCH2.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22179955 Gene-treatment interactions were observed for long-term (NEGR1 rs2815752, Pmetformin*SNP = 0.028; FTO rs9939609, Plifestyle*SNP = 0.044) weight loss.
21750520 Meta-analysis of 4992 subjects revealed seven SNPs near four loci, including NEGR1, TMEM18, SH2B1 /ATP2A1 and MC4R, showing significant association at 0.005
More...

AA Sequence

MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGA      1 - 70
WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPK     71 - 140
IYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVS    141 - 210
FPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRS    211 - 280
ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKN    281 - 350
AILQ                                                                      351 - 354
//

Text Mined References (51)

PMID Year Title
25640768 2015 Adult adiposity susceptibility loci, early growth and general and abdominal fatness in childhood: the Generation R Study.
25370040 2015 Novel genomic signals of recent selection in an Ethiopian population.
25245582 2015 Impact of NEGR1 genetic variability on psychological traits of patients with eating disorders.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25072390 2014 Obesity gene NEGR1 associated with white matter integrity in healthy young adults.
23950990 2013 Contribution of 32 GWAS-identified common variants to severe obesity in European adults referred for bariatric surgery.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
More...