Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.19635357649512E-10
pancreatic cancer 2300 7.56859354447261E-4
primary pancreatic ductal adenocarcinoma 1271 9.77472515981594E-4
osteosarcoma 7933 0.00221807637137953
ovarian cancer 8492 0.00303130373830272
breast carcinoma 1614 0.0034521236979951
group 3 medulloblastoma 2254 0.00787564161726594
Breast cancer 3099 0.0248609387717636

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.233 0.002
juvenile dermatomyositis 1.176 0.000
primary pancreatic ductal adenocarcinoma 1.567 0.001
breast carcinoma 1.400 0.003
Breast cancer 3.600 0.025
group 3 medulloblastoma 1.100 0.008
ovarian cancer -1.500 0.003
pancreatic cancer 1.500 0.001

Synonym

Accession Q7Z3B0 B9EJC4
Symbols C5orf43

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKR      1 - 70
LKKD                                                                       71 - 74
//

Text Mined References (5)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.