Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 3.600 2.5e-02
breast carcinoma 1.400 3.5e-03
group 3 medulloblastoma 1.100 7.9e-03
juvenile dermatomyositis 1.176 4.2e-10
osteosarcoma 1.233 2.2e-03
ovarian cancer -1.500 3.0e-03
pancreatic cancer 1.500 7.6e-04
primary pancreatic ductal adenocarcinoma 1.567 9.8e-04

AA Sequence

MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKR      1 - 70
LKKD                                                                       71 - 74
//

Text Mined References (5)

PMID Year Title