Property Summary

NCBI Gene PubMed Count 33
Grant Count 24
R01 Count 19
Funding $3,620,849.42
PubMed Score 134.55
PubTator Score 104.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 0.001
astrocytoma 3.000 0.000
glioblastoma 2.100 0.002
oligodendroglioma 1.200 0.000
osteosarcoma -1.820 0.000
ependymoma 1.200 0.000
juvenile dermatomyositis 1.629 0.000
Atopic dermatitis 1.700 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.015
intraductal papillary-mucinous carcinoma... 1.200 0.044
lung cancer -1.700 0.000
Multiple Sclerosis 1.400 0.007
cystic fibrosis 1.200 0.007
pediatric high grade glioma 1.400 0.000
group 4 medulloblastoma -1.600 0.000
pilocytic astrocytoma 1.600 0.000
psoriasis 1.500 0.000
subependymal giant cell astrocytoma 2.313 0.004
Pick disease 1.100 0.008
ulcerative colitis 1.400 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.400 0.004

Gene RIF (21)

PMID Text
26625984 Herpes simplex virus 1 UL41 was shown for the first time to evade the antiviral function of human ZAP via its RNase activity.
26129669 Suppressing Matrin 3 powers a heightened and broader ZAP restriction of HIV-1 gene expression.
26001115 The association of the ZAP ribonucleoprotein particle with many interferon-stimulated gene products indicates it may be a key player in the interferon response.
25851173 PARP13 regulates RNA in stress and disease. [review]
25635049 results show that PARP13 lacks the structural requirements for ADP-ribosyltransferase activity
25631074 Cellular biotinylated zinc finger CCCH-type, antiviral 1 (ZC3HAV1) protein is incorporated into HIV-1 Gag virus-like particles
25382312 PARP13 regulates cellular mRNA post-transcriptionally and functions as a pro-apoptotic factor by destabilizing TRAILR4 transcript.
25010285 Cellular biotinylated zinc finger CCCH-type, antiviral 1 (ZC3HAV1) protein is incorporated into HIV-1 Gag virus-like particles
24457973 Contrary to previous assumptions, these results indicate an essential function of the PARP-like domain in hZAP-L's antiviral activity.
23853601 Data suggest that two isoforms of ZAP (ZAP-long and -short) inhibit replication of hepatitis B virus and replication of viral DNA in hepatocytes through posttranscriptional down-regulation of viral RNA.
More...

AA Sequence

MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRA      1 - 70
RVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQ     71 - 140
SDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPD    141 - 210
VVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQIS    211 - 280
HRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLA    281 - 350
SNSTSAPNWKSLTSWTNDQGARRKTVFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQ    351 - 420
DIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVN    421 - 490
DSLSDVTSTTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYC    491 - 560
NPGIHLCSVGSYTINFRVMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWYWKNESGTWIQYGEEKDKRKN    561 - 630
SNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPDH    631 - 700
QPAKTSSVSLTATFRPQEDFCFLSSKKYKLSEIHHLHPEYVRVSEHFKASMKNFKIEKIKKIENSELLDK    701 - 770
FTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKYGKGIYFAKDAIYSHKNCPYDAKNVVM    771 - 840
FVAQVLVGKFTEGNITYTSPPPQFDSCVDTRSNPSVFVIFQKDQVYPQYVIEYTEDKACVIS            841 - 902
//

Text Mined References (51)

PMID Year Title
26625984 2015 Herpes simplex virus 1 UL41 protein abrogates the antiviral activity of hZAP by degrading its mRNA.
26129669 2015 Nuclear matrix protein Matrin 3 is a regulator of ZAP-mediated retroviral restriction.
26001115 2015 The Broad-Spectrum Antiviral Protein ZAP Restricts Human Retrotransposition.
25851173 2015 Poly(ADP-ribose) polymerase-13 and RNA regulation in immunity and cancer.
25635049 2015 Structural basis for lack of ADP-ribosyltransferase activity in poly(ADP-ribose) polymerase-13/zinc finger antiviral protein.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25382312 2014 PARP13 regulates cellular mRNA post-transcriptionally and functions as a pro-apoptotic factor by destabilizing TRAILR4 transcript.
24457973 2014 The alternate triad motif of the poly(ADP-ribose) polymerase-like domain of the human zinc finger antiviral protein is essential for its antiviral activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23853601 2013 Inhibition of hepatitis B virus replication by the host zinc finger antiviral protein.
More...