Property Summary

NCBI Gene PubMed Count 33
PubMed Score 134.55
PubTator Score 104.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.24150983036629E-14
oligodendroglioma 2849 1.23264913656205E-13
psoriasis 6685 5.58316436833268E-13
pilocytic astrocytoma 3086 1.72155505222903E-8
ependymoma 2514 1.34589332199613E-7
pediatric high grade glioma 2712 7.65768322475321E-7
ovarian cancer 8492 9.09362934397734E-6
Atopic dermatitis 944 1.24671964667897E-5
ulcerative colitis 2087 1.46702236401066E-5
lung cancer 4473 1.04517509223662E-4
astrocytoma 1493 1.38661293605866E-4
osteosarcoma 7933 1.72299777735439E-4
group 4 medulloblastoma 1875 3.11036854415262E-4
cutaneous lupus erythematosus 1056 6.72814156244008E-4
glioblastoma 5572 0.00232260367202932
dermatomyositis 967 0.00416824104789823
subependymal giant cell astrocytoma 2287 0.00435634297116347
cystic fibrosis 1670 0.00715834829158882
Multiple Sclerosis 498 0.00723773056581233
Pick disease 1893 0.00806383151925356
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0154977396868165
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0438824951824852
Disease Target Count Z-score Confidence
Leptospirosis 17 3.076 1.5

Expression

  Differential Expression (22)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 0.001
astrocytoma 3.000 0.000
glioblastoma 2.100 0.002
oligodendroglioma 1.200 0.000
osteosarcoma -1.820 0.000
ependymoma 1.200 0.000
juvenile dermatomyositis 1.629 0.000
Atopic dermatitis 1.700 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.015
intraductal papillary-mucinous carcinoma... 1.200 0.044
lung cancer -1.700 0.000
Multiple Sclerosis 1.400 0.007
cystic fibrosis 1.200 0.007
pediatric high grade glioma 1.400 0.000
group 4 medulloblastoma -1.600 0.000
pilocytic astrocytoma 1.600 0.000
psoriasis 1.500 0.000
subependymal giant cell astrocytoma 2.313 0.004
Pick disease 1.100 0.008
ulcerative colitis 1.400 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.400 0.004

Synonym

Accession Q7Z2W4 A4D1R2 A4D1S4 Q8IW57 Q8TAJ3 Q96N79 Q9H8R9 Q9P0Y7
Symbols ZAP
ZC3H2
ARTD13
PARP13
FLB6421
ZC3HDC2

Gene

PANTHER Protein Class (1)

PDB

2X5Y   4X52  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG

 MGI Term (1)

Gene RIF (21)

PMID Text
26625984 Herpes simplex virus 1 UL41 was shown for the first time to evade the antiviral function of human ZAP via its RNase activity.
26129669 Suppressing Matrin 3 powers a heightened and broader ZAP restriction of HIV-1 gene expression.
26001115 The association of the ZAP ribonucleoprotein particle with many interferon-stimulated gene products indicates it may be a key player in the interferon response.
25851173 PARP13 regulates RNA in stress and disease. [review]
25635049 results show that PARP13 lacks the structural requirements for ADP-ribosyltransferase activity
25631074 Cellular biotinylated zinc finger CCCH-type, antiviral 1 (ZC3HAV1) protein is incorporated into HIV-1 Gag virus-like particles
25382312 PARP13 regulates cellular mRNA post-transcriptionally and functions as a pro-apoptotic factor by destabilizing TRAILR4 transcript.
25010285 Cellular biotinylated zinc finger CCCH-type, antiviral 1 (ZC3HAV1) protein is incorporated into HIV-1 Gag virus-like particles
24457973 Contrary to previous assumptions, these results indicate an essential function of the PARP-like domain in hZAP-L's antiviral activity.
23853601 Data suggest that two isoforms of ZAP (ZAP-long and -short) inhibit replication of hepatitis B virus and replication of viral DNA in hepatocytes through posttranscriptional down-regulation of viral RNA.
More...

AA Sequence

MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRA      1 - 70
RVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQ     71 - 140
SDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPD    141 - 210
VVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQIS    211 - 280
HRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLA    281 - 350
SNSTSAPNWKSLTSWTNDQGARRKTVFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQ    351 - 420
DIQPGPLFNNNADGVATDITSTRSLNYKSTSSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVN    421 - 490
DSLSDVTSTTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYC    491 - 560
NPGIHLCSVGSYTINFRVMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWYWKNESGTWIQYGEEKDKRKN    561 - 630
SNVDSSYLESLYQSCPRGVVPFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPDH    631 - 700
QPAKTSSVSLTATFRPQEDFCFLSSKKYKLSEIHHLHPEYVRVSEHFKASMKNFKIEKIKKIENSELLDK    701 - 770
FTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKYGKGIYFAKDAIYSHKNCPYDAKNVVM    771 - 840
FVAQVLVGKFTEGNITYTSPPPQFDSCVDTRSNPSVFVIFQKDQVYPQYVIEYTEDKACVIS            841 - 902
//

Text Mined References (51)

PMID Year Title
26625984 2015 Herpes simplex virus 1 UL41 protein abrogates the antiviral activity of hZAP by degrading its mRNA.
26129669 2015 Nuclear matrix protein Matrin 3 is a regulator of ZAP-mediated retroviral restriction.
26001115 2015 The Broad-Spectrum Antiviral Protein ZAP Restricts Human Retrotransposition.
25851173 2015 Poly(ADP-ribose) polymerase-13 and RNA regulation in immunity and cancer.
25635049 2015 Structural basis for lack of ADP-ribosyltransferase activity in poly(ADP-ribose) polymerase-13/zinc finger antiviral protein.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25382312 2014 PARP13 regulates cellular mRNA post-transcriptionally and functions as a pro-apoptotic factor by destabilizing TRAILR4 transcript.
24457973 2014 The alternate triad motif of the poly(ADP-ribose) polymerase-like domain of the human zinc finger antiviral protein is essential for its antiviral activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23853601 2013 Inhibition of hepatitis B virus replication by the host zinc finger antiviral protein.
More...