Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 547.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z2V1 B9EGC2 Q8NEF0
Symbols TNT

Gene

  Ortholog (1)

Species Source Disease
Rat OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MSLVPGQHCSPSHTRLHLTSPITMGTEPATQNTEFSKGSLIYGVTSPQRGHSQHSEASQGPLSLDKPLQL      1 - 70
PPIFLEGEKGESSVQNEQEGEPSLQSPSLELQSPAWPRHAGVAQEPLKVSSSYLSDTQSSESHVSSVQHP     71 - 140
RPEEGSHASLSSGYAGDKEGSDISLVGSHRRVRLNRRLNTQAASNQTSQLGSIDPPSSLKSRLTGPAHST    141 - 210
KQTGGKE                                                                   211 - 217
//

Text Mined References (3)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.