Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 547.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q7Z2V1 B9EGC2 Q8NEF0
Symbols TNT

Gene

 Compartment GO Term (0)

AA Sequence

MSLVPGQHCSPSHTRLHLTSPITMGTEPATQNTEFSKGSLIYGVTSPQRGHSQHSEASQGPLSLDKPLQL      1 - 70
PPIFLEGEKGESSVQNEQEGEPSLQSPSLELQSPAWPRHAGVAQEPLKVSSSYLSDTQSSESHVSSVQHP     71 - 140
RPEEGSHASLSSGYAGDKEGSDISLVGSHRRVRLNRRLNTQAASNQTSQLGSIDPPSSLKSRLTGPAHST    141 - 210
KQTGGKE                                                                   211 - 217
//

Text Mined References (3)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.