Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q7Z2R9
Symbols MST128
MSTP128
C1orf191

AA Sequence

MWGFLVLKARWLVTPVRTLATEAGQKPSLRGLLDVGNIQHRAARARGLTRGVIRVSPQERSQQNQSAPKG      1 - 70
PTPSTRPKPRTLGPQAHSLALQSVDLLFRP                                             71 - 100
//

Text Mined References (1)

PMID Year Title