Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MGARGALLLALLLARAGLGKPGELGALQAGPGAARRPGGGGREEACGHREIHALVAGGVESARGRWPWQA      1 - 70
SLRLRRRHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDA     71 - 140
LGVLRNDIALLRLASSVTYNAYIQPICIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTIL    141 - 210
NNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPG    211 - 280
VYTNISVYFHWIRRVMSHSTPRPNPSQLLLLLALLWAP                                    281 - 318
//

Text Mined References (3)

PMID Year Title
20797691 2010 A focal epilepsy and intellectual disability syndrome is due to a mutation in TBC1D24.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12838346 2003 Human and mouse proteases: a comparative genomic approach.