Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available

AA Sequence

VYTNISVYFHWIRRVMSHSTPRPNPSQLLLLLALLWAP                                    281 - 318

Text Mined References (3)

PMID Year Title