Property Summary

NCBI Gene PubMed Count 13
PubMed Score 102.69
PubTator Score 56.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.1e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 2.042 1.1e-05

 MGI Phenotype (1)

Gene RIF (3)

AA Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY      1 - 70
YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR                                   71 - 110
//

Text Mined References (20)

PMID Year Title