Property Summary

NCBI Gene PubMed Count 13
Grant Count 15
R01 Count 5
Funding $1,865,915.19
PubMed Score 96.18
PubTator Score 56.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 2.042 0.000

Gene RIF (3)

PMID Text
26244496 We found PHF5A, a component of the U2 snRNP mRNA splicing factor, blocks expression from recombinant Adeno-associated virus vectors
23651857 PHF5A facilitates recognition of exons with unusual C-rich 3' splice sites in thousands of essential genes
12054543 The molecular and genetic research in this paper is performed on mouse but the paper identifies and discusses homologues found in human genomic sequence databases.

AA Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY      1 - 70
YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR                                   71 - 110
//

Text Mined References (18)

PMID Year Title
26244496 2015 An siRNA Screen Identifies the U2 snRNP Spliceosome as a Host Restriction Factor for Recombinant Adeno-associated Viruses.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23651857 2013 Genome-wide RNAi screens in human brain tumor isolates reveal a novel viability requirement for PHF5A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18076038 2008 Complex assembly mechanism and an RNA-binding mode of the human p14-SF3b155 spliceosomal protein complex identified by NMR solution structure and functional analyses.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...