Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.10
PubTator Score 9.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAA      1 - 70
NVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHGPA     71 - 140
ARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCPPHAPLARPSAVAEGPGLAQASGGSWRRCPG    141 - 210
ASSAGPPPWPRGYLRSAPGMGHPRS                                                 211 - 235
//

Text Mined References (12)

PMID Year Title