Property Summary

NCBI Gene PubMed Count 5
Grant Count 8
Funding $2,421,500
PubMed Score 6.17
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Atrioventricular block 21 3.12 1.6

Expression

Gene RIF (2)

PMID Text
24571987 Transcription factor 23 (Tcf23), a basic-helix-loop-helix transcription factor, is a new progesterone-induced target gene that requires SRC-2 for full induction.
10652346 Study of the orthologous gene in mouse shows the encoded protein does not bind DNA but may negatively regulate other basic helix-loop-helix factors via the formation of a functionally inactive heterodimeric complex.

AA Sequence

MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATPGPRGTRAGGL      1 - 70
ALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVLAASYIAHLTRTLGHELPGPA     71 - 140
WPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTASTPSQRTRDAEVGSQVPGEADALLSTTPLSPA    141 - 210
LGDK                                                                      211 - 214
//

Text Mined References (7)

PMID Year Title
24571987 2014 A murine uterine transcriptome, responsive to steroid receptor coactivator-2, reveals transcription factor 23 as essential for decidualization of human endometrial stromal cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11701948 2001 Genomic organization and chromosomal mapping of the basic helix-loop-helix factor OUT (Tcf23/TCF23).
10652346 2000 OUT, a novel basic helix-loop-helix transcription factor with an Id-like inhibitory activity.