Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.17
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Atrioventricular block 35 3.157 1.6

Expression

Synonym

Accession Q7RTU1 B2RNZ3 TCF-23
Symbols OUT
TCF-23
bHLHa24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATPGPRGTRAGGL      1 - 70
ALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVLAASYIAHLTRTLGHELPGPA     71 - 140
WPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTASTPSQRTRDAEVGSQVPGEADALLSTTPLSPA    141 - 210
LGDK                                                                      211 - 214
//

Text Mined References (7)

PMID Year Title