Tbio | Ribonucleoside-diphosphate reductase subunit M2 B |
Plays a pivotal role in cell survival by repairing damaged DNA in a p53/TP53-dependent manner. Supplies deoxyribonucleotides for DNA repair in cells arrested at G1 or G2. Contains an iron-tyrosyl free radical center required for catalysis. Forms an active ribonucleotide reductase (RNR) complex with RRM1 which is expressed both in resting and proliferating cells in response to DNA damage.
This gene encodes the small subunit of a p53-inducible ribonucleotide reductase. This heterotetrameric enzyme catalyzes the conversion of ribonucleoside diphosphates to deoxyribonucleoside diphosphates. The product of this reaction is necessary for DNA synthesis. Mutations in this gene have been associated with autosomal recessive mitochondrial DNA depletion syndrome, autosomal dominant progressive external ophthalmoplegia-5, and mitochondrial neurogastrointestinal encephalopathy. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2010]
This gene encodes the small subunit of a p53-inducible ribonucleotide reductase. This heterotetrameric enzyme catalyzes the conversion of ribonucleoside diphosphates to deoxyribonucleoside diphosphates. The product of this reaction is necessary for DNA synthesis. Mutations in this gene have been associated with autosomal recessive mitochondrial DNA depletion syndrome, autosomal dominant progressive external ophthalmoplegia-5, and mitochondrial neurogastrointestinal encephalopathy. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2010]
Comments
Disease | Target Count | P-value |
---|---|---|
acute quadriplegic myopathy | 1157 | 4.83647335432481E-6 |
tuberculosis | 1563 | 3.40952584585001E-5 |
medulloblastoma | 1524 | 0.00170733186360176 |
ovarian cancer | 8492 | 0.00253087449291354 |
atypical teratoid / rhabdoid tumor | 4369 | 0.00410959445522848 |
subependymal giant cell astrocytoma | 2287 | 0.0128162542511067 |
medulloblastoma, large-cell | 6234 | 0.0257801490082311 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Chronic progressive external ophthalmoplegia | 18 | 5.368 | 2.7 |
Neuropathy | 210 | 0.0 | 4.0 |
Disease | Target Count |
---|---|
Mitochondrial DNA depletion syndrome 8A | 1 |
Mitochondrial DNA depletion syndrome 8B | 1 |
Disease | log2 FC | p |
---|---|---|
atypical teratoid / rhabdoid tumor | -1.100 | 0.004 |
medulloblastoma | -1.200 | 0.002 |
medulloblastoma, large-cell | -1.500 | 0.026 |
acute quadriplegic myopathy | 1.634 | 0.000 |
tuberculosis | -1.100 | 0.000 |
subependymal giant cell astrocytoma | 1.966 | 0.013 |
ovarian cancer | 1.700 | 0.003 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA EggNOG |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
S.cerevisiae | OMA Inparanoid |
PMID | Text |
---|---|
25878246 | analysis of caspase-dependent degradation of human R2 and p53R2 small subunits |
25312903 | A newly discovered role of E2F1 in the regulation of p53R2 expression in DNA damage response. |
24947616 | Data indicate that forkhead transcription factorsF OXO3 directly bound to and transcriptionally activated the promoter of ribonucleotide reductase subunit RRM2B, and induced the expression of RRM2B at RNA and protein levels. |
24861915 | in Turkish population p53R2 genotype distributions between head and neck squamous epithelial cell cancer patients and control groups were not statistically significantly different. |
24215511 | we found no support of the hypothesis that aberrations of RRM1 or RRM2B, neither individually nor in combination, are associated with an altered clinical outcome following chemotherapy. |
24214128 | Ribonucleotide reductase M2B inhibits cell migration and spreading by early growth response protein 1-mediated phosphatase and tensin homolog/Akt1 pathway in hepatocellular carcinoma. |
24162774 | HIV-1 gp120 upregulates the expression of ribonucleotide reductase M2 B (RRM2B) in human B cells |
23552804 | RRM2B expression may discriminate cervical cancer phenotype and radiochemotherapy outcome |
23139867 | RRM2B is highly induced in a p53-dependent manner during senescence and is expressed at higher levels in senescent precancerous human prostatic intraepithelial neoplasm lesions compared to adjacent normal prostate glands. |
22954457 | p53R2 could regulate matrix synthesis via Akt phosphorylation during chondrocyte mechanotransduction. Down-regulation of p53R2 may be a new therapeutic approach in OA therapy. |
More... |
MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVD 1 - 70 LSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL 71 - 140 LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKK 141 - 210 RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCI 211 - 280 LMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD 281 - 350 F//
PMID | Year | Title |
---|---|---|
26741492 | 2016 | A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies. |
25878246 | 2015 | Caspase-dependent Proteolysis of Human Ribonucleotide Reductase Small Subunits R2 and p53R2 during Apoptosis. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25312903 | 2015 | E2F1 regulates p53R2 gene expression in p53-deficient cells. |
24947616 | 2014 | Tumor suppressor FOXO3 regulates ribonucleotide reductase subunit RRM2B and impacts on survival of cancer patients. |
24861915 | 2014 | Investigation of the association of hRRM1 and p53R2 gene polymorphisms in head and neck squamous cell carcinomas. |
24215511 | 2013 | Gene aberrations of RRM1 and RRM2B and outcome of advanced breast cancer after treatment with docetaxel with or without gemcitabine. |
24214128 | 2014 | Ribonucleotide reductase M2B inhibits cell migration and spreading by early growth response protein 1-mediated phosphatase and tensin homolog/Akt1 pathway in hepatocellular carcinoma. |
23552804 | 2013 | Ribonucleotide reductase expression in cervical cancer: a radiation therapy oncology group translational science analysis. |
23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. |
More... |