Property Summary

NCBI Gene PubMed Count 54
Grant Count 22
R01 Count 14
Funding $1,156,123.58
PubMed Score 86.40
PubTator Score 97.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.004
medulloblastoma -1.200 0.002
medulloblastoma, large-cell -1.500 0.026
acute quadriplegic myopathy 1.634 0.000
tuberculosis -1.100 0.000
subependymal giant cell astrocytoma 1.966 0.013
ovarian cancer 1.700 0.003

Gene RIF (46)

PMID Text
25878246 analysis of caspase-dependent degradation of human R2 and p53R2 small subunits
25312903 A newly discovered role of E2F1 in the regulation of p53R2 expression in DNA damage response.
24947616 Data indicate that forkhead transcription factorsF OXO3 directly bound to and transcriptionally activated the promoter of ribonucleotide reductase subunit RRM2B, and induced the expression of RRM2B at RNA and protein levels.
24861915 in Turkish population p53R2 genotype distributions between head and neck squamous epithelial cell cancer patients and control groups were not statistically significantly different.
24215511 we found no support of the hypothesis that aberrations of RRM1 or RRM2B, neither individually nor in combination, are associated with an altered clinical outcome following chemotherapy.
24214128 Ribonucleotide reductase M2B inhibits cell migration and spreading by early growth response protein 1-mediated phosphatase and tensin homolog/Akt1 pathway in hepatocellular carcinoma.
24162774 HIV-1 gp120 upregulates the expression of ribonucleotide reductase M2 B (RRM2B) in human B cells
23552804 RRM2B expression may discriminate cervical cancer phenotype and radiochemotherapy outcome
23139867 RRM2B is highly induced in a p53-dependent manner during senescence and is expressed at higher levels in senescent precancerous human prostatic intraepithelial neoplasm lesions compared to adjacent normal prostate glands.
22954457 p53R2 could regulate matrix synthesis via Akt phosphorylation during chondrocyte mechanotransduction. Down-regulation of p53R2 may be a new therapeutic approach in OA therapy.
More...

AA Sequence

MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVD      1 - 70
LSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL     71 - 140
LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKK    141 - 210
RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCI    211 - 280
LMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD    281 - 350
F//

Text Mined References (58)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
25878246 2015 Caspase-dependent Proteolysis of Human Ribonucleotide Reductase Small Subunits R2 and p53R2 during Apoptosis.
25416956 2014 A proteome-scale map of the human interactome network.
25312903 2015 E2F1 regulates p53R2 gene expression in p53-deficient cells.
24947616 2014 Tumor suppressor FOXO3 regulates ribonucleotide reductase subunit RRM2B and impacts on survival of cancer patients.
24861915 2014 Investigation of the association of hRRM1 and p53R2 gene polymorphisms in head and neck squamous cell carcinomas.
24215511 2013 Gene aberrations of RRM1 and RRM2B and outcome of advanced breast cancer after treatment with docetaxel with or without gemcitabine.
24214128 2014 Ribonucleotide reductase M2B inhibits cell migration and spreading by early growth response protein 1-mediated phosphatase and tensin homolog/Akt1 pathway in hepatocellular carcinoma.
23552804 2013 Ribonucleotide reductase expression in cervical cancer: a radiation therapy oncology group translational science analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...