Property Summary

NCBI Gene PubMed Count 17
PubMed Score 33.37
PubTator Score 27.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.629 2.8e-04
Amyotrophic lateral sclerosis 1.155 5.9e-05
Chronic Lymphocytic Leukemia 1.522 3.5e-04
cystic fibrosis -1.463 2.1e-05
gastric carcinoma 1.400 3.8e-02
group 4 medulloblastoma -2.100 2.2e-05
interstitial cystitis 2.000 5.4e-04
intraductal papillary-mucinous carcinoma... -1.900 2.3e-02
lung cancer -1.100 6.2e-03
lung carcinoma -1.200 5.9e-16
malignant mesothelioma 7.700 6.8e-10
medulloblastoma, large-cell -2.000 1.4e-04
ovarian cancer -2.000 2.6e-06
pituitary cancer -1.800 6.6e-06
posterior fossa group A ependymoma 1.100 3.2e-04
tuberculosis and treatment for 6 months -1.300 2.5e-03
ulcerative colitis 3.000 1.5e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGG      1 - 70
FLRFKKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSV     71 - 140
NNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTT    141 - 210
DPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVK    211 - 280
FSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASAS    281 - 350
TMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVT    351 - 420
EALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMH    421 - 490
KVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKT    491 - 560
T//

Text Mined References (19)

PMID Year Title