Property Summary

NCBI Gene PubMed Count 16
PubMed Score 26.59
PubTator Score 27.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 5.9413124447909E-16
malignant mesothelioma 3163 6.75720178911124E-10
ulcerative colitis 2087 1.52259808227656E-6
ovarian cancer 8492 2.59263444172559E-6
pituitary cancer 1972 6.63052486651253E-6
cystic fibrosis 1670 2.07636928229694E-5
group 4 medulloblastoma 1875 2.21396745073915E-5
interstitial cystitis 2299 2.26707795745196E-5
Amyotrophic Lateral Sclerosis 432 5.89131800449658E-5
medulloblastoma, large-cell 6234 1.37215093041809E-4
adrenocortical carcinoma 1427 2.75697339268439E-4
posterior fossa group A ependymoma 1511 3.24847679890929E-4
chronic lymphocytic leukemia 244 3.52262963529536E-4
tuberculosis and treatment for 6 months 686 0.00249905704318309
lung cancer 4473 0.00622570027224614
gastric carcinoma 832 0.0205793829700732
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0234072315933402

Expression

Synonym

Accession Q7LFX5 O60338 O60474 Q86VM4
Symbols BRAG
GALNAC4S-6ST

Gene

  Ortholog (11)

Gene RIF (3)

PMID Text
26642349 The direct action of CHST15 on the proliferation.
23349846 Findings indicate that GalNAc4S-6ST mRNA expressed by astrocytic tumor cells is associated with poor patient prognosis.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGG      1 - 70
FLRFKKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSV     71 - 140
NNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTT    141 - 210
DPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVK    211 - 280
FSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASAS    281 - 350
TMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVT    351 - 420
EALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMH    421 - 490
KVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKT    491 - 560
T//

Text Mined References (18)

PMID Year Title
26642349 2015 Inhibition of Cell Proliferation and Growth of Pancreatic Cancer by Silencing of Carbohydrate Sulfotransferase 15 In Vitro and in a Xenograft Model.
23349846 2013 Role of GalNAc4S-6ST in astrocytic tumor progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16024005 2005 Synthesis of sulfated phenyl 2-acetamido-2-deoxy-D-galactopyranosides. 4-O-Sulfated phenyl 2-acetamido-2-deoxy-beta-D-galactopyranoside is a competitive acceptor that decreases sulfation of chondroitin sulfate by N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12874280 2003 A unique nonreducing terminal modification of chondroitin sulfate by N-acetylgalactosamine 4-sulfate 6-o-sulfotransferase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...