Property Summary

NCBI Gene PubMed Count 48
Grant Count 9
R01 Count 8
Funding $344,492.8
PubMed Score 30.21
PubTator Score 16.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.402 0.001
ovarian cancer 2.200 0.000

Gene RIF (25)

PMID Text
26318036 our results indicate that CSN6 is a positive regulator of E6AP and is important for cervical cancer development.
26267535 Findings indicate that the deregulation of beta-catenin by extracellular signal-regulated kinase 2 (ERK2)-activated CSN6 protein is important for colorectal cancer (CRC) development.
26237449 CSN6 positively regulates c-Jun in a MEKK1-dependent manner
25945542 CSN6 interacts with p27(Kip1) and facilitates ubiquitin-mediated degradation of p27(Kip1).
25242525 Analyses of the pseudo metal-binding motif in CSN6 suggest that the loss of two key histidine residues may contribute to the lack of catalytic activity in CSN6.
23187808 Data suggest that CSN6 is an important negative regulator of p57 (Kip2) , and that overexpression of CSN6 in many types of cancer could lead to decreased expression of p57 (Kip2) and result in promoted cancer cell growth.
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21555518 COPS6 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21317535 loss of CSN6 enhances p53-mediated tumor suppression in vivo and CSN6 plays an important role in regulating DNA damage-associated apoptosis and tumorigenesis through control of the MDM2-p53 signaling pathway
18060501 For the first time our data demonstrate that CSN-mediated deneddylation can be regulated by active Casp3 and that the CSN executes a specific function during the apoptotic process.
More...

AA Sequence

MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIG      1 - 70
ALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHK     71 - 140
QVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATG    141 - 210
SGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFY    211 - 280
DQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF                           281 - 327
//

Text Mined References (50)

PMID Year Title
26456823 2015 CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome.
26318036 2015 COP9 signalosome subunit 6 (CSN6) regulates E6AP/UBE3A in cervical cancer.
26267535 2015 ERK2-Dependent Phosphorylation of CSN6 Is Critical in Colorectal Cancer Development.
26237449 2015 CSN6 positively regulates c-Jun in a MEKK1-dependent manner.
25945542 2015 Regulating the stability and localization of CDK inhibitor p27(Kip1) via CSN6-COP1 axis.
25242525 2014 Crystal structure of the human CSN6 MPN domain.
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23187808 2012 CDK inhibitor p57 (Kip2) is negatively regulated by COP9 signalosome subunit 6.
More...