Property Summary

NCBI Gene PubMed Count 53
PubMed Score 32.91
PubTator Score 16.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 3.5e-05
Multiple myeloma 1332 5.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.402 5.8e-04
ovarian cancer 2.200 3.5e-05

Gene RIF (23)

AA Sequence

MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIG      1 - 70
ALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHK     71 - 140
QVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATG    141 - 210
SGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFY    211 - 280
DQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF                           281 - 327
//

Text Mined References (55)

PMID Year Title