Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.70
PubTator Score 36.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.7e-04
tuberculosis and treatment for 6 months 409 1.3e-03
osteosarcoma 7950 1.6e-03
aldosterone-producing adenoma 665 1.8e-02
Disease Target Count Z-score Confidence
Myopia 176 3.461 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
aldosterone-producing adenoma -1.096 1.8e-02
osteosarcoma -1.053 1.6e-03
psoriasis -1.200 1.7e-04
tuberculosis and treatment for 6 months -1.100 1.3e-03

Gene RIF (5)

AA Sequence

MSVLLRSGLGPLCAVARAAIPFIWRGKYFSSGNEPAENPVTPMLRHLMYKIKSTGPITVAEYMKEVLTNP      1 - 70
AKGYYVYRDMLGEKGDFITSPEISQIFGELLGIWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQ     71 - 140
LGSVLKNCDISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYS    141 - 210
FYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHVEVCPDAGV    211 - 280
IIEELSQRIALTGGAALVADYGHDGTKTDTFRGFCDHKLHDVLIAPGTADLTADVDFSYLRRMAQGKVAS    281 - 350
LGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQR    351 - 420
NARQSKPFASVVAGFSELAWQ                                                     421 - 441
//

Text Mined References (15)

PMID Year Title