Property Summary

NCBI Gene PubMed Count 28
PubMed Score 9.60
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.7e-11
non primary Sjogren syndrome sicca 891 2.5e-02
acute myeloid leukemia 783 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Embryonal carcinoma 10 3.349 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -2.500 3.1e-02
non primary Sjogren syndrome sicca -1.200 2.5e-02
osteosarcoma -3.674 1.7e-11

Gene RIF (5)

AA Sequence

MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHT      1 - 70
DNPRPQKKIPIPPLPSKLPPVNLIHRDILRAWCQQLKLSSKGQKLDAYKRLCAFAYPNQKDFPSTAKEAK     71 - 140
IRKSLQKKLKVEKGETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSAPEALLASWARIS    141 - 210
ARARTPEAVESPQEASGVRWCVVHGKSLPADTDGWVHLQFHAGQAWVPEKQEGRVSALFLLPASNFPPPH    211 - 280
LEDNMLCPKCVHRNKVLIKSLQWE                                                  281 - 304
//

Text Mined References (30)

PMID Year Title