Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.25
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
fibroadenoma 1.500 0.028
adult high grade glioma -1.400 0.006
lung adenocarcinoma 1.200 0.002

Synonym

Accession Q76KP1 Q96LV2 NGalNAc-T1
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
25858323 These results indicate that the expression of the LacdiNAc group is quite important for the suppression of malignancies of the MDA-MB-231 cells.
22722940 Peptide-specific transfer of N-acetylgalactosamine to O-linked glycans by the glycosyltransferases beta1,4-N-acetylgalactosaminyl transferase 3 (beta4GalNAc-T3) and beta4GalNAc-T4.
22722937 Molecular basis for protein-specific transfer of N-acetylgalactosamine to N-linked glycans by the glycosyltransferases beta1,4-N-acetylgalactosaminyl transferase 3 (beta4GalNAc-T3) and beta4GalNAc-T4.
18854154 Knockdown of beta-1,4-N-acetyl-galactosaminyl transferase 4 (B4GALNT4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18048353 betaGT3 and betaGT4, that are able to transfer GalNAc to GlcNAc in beta1,4-linkage display the necessary glycoprotein specificity in vivo.
15044014 molecular cloning and characterization; specificity toward oligosaccharide acceptor substrates was quite similar to beta4GalNAc-T3 in vitro but the tissue distributions of the two enzymes were quite different

AA Sequence

MPRLPVKKIRKQMKLLLLLLLLSCAAWLTYVHLGLVRQGRALRQRLGYGRDGEKLTSETDGRGVHAAPST      1 - 70
QRAEDSSESREEEQAPEGRDLDMLFPGGAGRLPLNFTHQTPPWREEYKGQVNLHVFEDWCGGAVGHLRRN     71 - 140
LHFPLFPHTRTTVKKLAVSPKWKNYGLRIFGFIHPARDGDVQFSVASDDNSEFWLSLDESPAAAQLVAFV    141 - 210
GKTGSEWTAPGEFTKFSSQVSKPRRLMASRRYYFELLHKQDDRGSDHVEVGWRAFLPGLKFEVISSAHIS    211 - 280
LYTDESALKMDHVAHVPQSPASHVGGRPPQEETSADMLRPDPRDTFFLTPRMESSSLENVLEPCAYAPTY    281 - 350
VVKDFPIARYQGLQFVYLSFVYPNDYTRLTHMETDNKCFYRESPLYLERFGFYKYMKMDKEEGDEDEEDE    351 - 420
VQRRAFLFLNPDDFLDDEDEGELLDSLEPTEAAPPRSGPQSPAPAAPAQPGATLAPPTPPRPRDGGTPRH    421 - 490
SRALSWAARAARPLPLFLGRAPPPRPAVEQPPPKVYVTRVRPGQRASPRAPAPRAPWPPFPGVFLHPRPL    491 - 560
PRVQLRAPPRPPRPHGRRTGGPQATQPRPPARAQATQGGREGQARTLGPAAPTVDSNLSSEARPVTSFLS    561 - 630
LSQVSGPQLPGEGEEEEEGEDDGAPGDEAASEDSEEAAGPALGRWREDAIDWQRTFSVGAVDFELLRSDW    631 - 700
NDLRCNVSGNLQLPEAEAVDVTAQYMERLNARHGGRFALLRIVNVEKRRDSARGSRFLLELELQERGGGR    701 - 770
LRLSEYVFLRLPGARVGDADGESPEPAPAASVRPDGRPELCRPLRLAWRQDVMVHFIVPVKNQARWVAQF    771 - 840
LADMAALHARTGDSRFSVVLVDFESEDMDVERALRAARLPRYQYLRRTGNFERSAGLQAGVDAVEDASSI    841 - 910
VFLCDLHIHFPPNILDGIRKHCVEGRLAFAPVVMRLSCGSSPRDPHGYWEVNGFGLFGIYKSDFDRVGGM    911 - 980
NTEEFRDQWGGEDWELLDRVLQAGLEVERLRLRNFYHHYHSKRGMWSVRSRKGSRTGAS               981 - 1039
//

Text Mined References (8)

PMID Year Title
25858323 2015 Enhanced expression of the ?4-N-acetylgalactosaminyltransferase 4 gene impairs tumor growth of human breast cancer cells.
22722940 2012 Peptide-specific transfer of N-acetylgalactosamine to O-linked glycans by the glycosyltransferases ?1,4-N-acetylgalactosaminyl transferase 3 (?4GalNAc-T3) and ?4GalNAc-T4.
22722937 2012 Molecular basis for protein-specific transfer of N-acetylgalactosamine to N-linked glycans by the glycosyltransferases ?1,4-N-acetylgalactosaminyl transferase 3 (?4GalNAc-T3) and ?4GalNAc-T4.
18048353 2008 A necessary and sufficient determinant for protein-selective glycosylation in vivo.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15044014 2004 Molecular cloning and characterization of beta1,4-N-acetylgalactosaminyltransferases IV synthesizing N,N'-diacetyllactosediamine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.