Property Summary

NCBI Gene PubMed Count 35
PubMed Score 115.76
PubTator Score 60.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.095 5.6e-03
astrocytic glioma -1.800 4.9e-03
ependymoma -1.800 1.0e-02
glioblastoma -1.100 1.8e-02
group 3 medulloblastoma -2.200 1.0e-02
lung adenocarcinoma -1.400 2.1e-13
lung carcinoma 3.000 6.6e-29
medulloblastoma, large-cell -1.500 3.2e-02
ovarian cancer -1.900 3.1e-11
pediatric high grade glioma -1.500 3.4e-03
pituitary cancer 1.100 1.4e-06
primitive neuroectodermal tumor -2.200 1.8e-02

Gene RIF (21)

AA Sequence

MGDPDLLEVLAEEGEKVNKHIDYSFQMSEQSLSSRETSFLINEETMPAKRFNLFLRRRLMFQKNQQSKDS      1 - 70
IFFRDGIRQIDFVLSYVDDVKKDAELKAERRKEFETNLRKTGLELEIEDKRDSEDGRTYFVKIHAPWEVL     71 - 140
VTYAEVLGIKMPIKESDIPRPKHTPISYVLGPVRLPLSVKYPHPEYFTAQFSRHRQELFLIEDQATFFPS    141 - 210
SSRNRIVYYILSRCPFGIEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNWARF    211 - 280
SYFYKEQPLDLIKNYYGEKIGIYFVFLGFYTEMLFFAAVVGLACFIYGLLSMEHNTSSTEICDPEIGGQM    281 - 350
IMCPLCDQVCDYWRLNSTCLASKFSHLFDNESTVFFAIFMGIWVTLFLEFWKQRQARLEYEWDLVDFEEE    351 - 420
QQQLQLRPEFEAMCKHRKLNAVTKEMEPYMPLYTRIPWYFLSGATVTLWMSLVVTSMVAVIVYRLSVFAT    421 - 490
FASFMESDASLKQVKSFLTPQITTSLTGSCLNFIVILILNFFYEKISAWITKMEIPRTYQEYESSLTLKM    491 - 560
FLFQFVNFYSSCFYVAFFKGKFVGYPGKYTYLFNEWRSEECDPGGCLIELTTQLTIIMTGKQIFGNIKEA    561 - 630
IYPLALNWWRRRKARTNSEKLYSRWEQDHDLESFGPLGLFYEYLETVTQFGFVTLFVASFPLAPLLALIN    631 - 700
NIVEIRVDAWKLTTQYRRTVASKAHSIGVWQDILYGMAVLSVATNAFIVAFTSDIIPRLVYYYAYSTNAT    701 - 770
QPMTGYVNNSLSVFLIADFPNHTAPSEKRDFITCRYRDYRYPPDDENKYFHNMQFWHVLAAKMTFIIVME    771 - 840
HVVFLVKFLLAWMIPDVPKDVVERIKREKLMTIKILHDFELNKLKENLGINSNEFAKHVMIEENKAQLAK    841 - 910
STL                                                                       911 - 913
//

Text Mined References (38)

PMID Year Title