Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.64

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEEAAAAPISPWTMAATIQAMERKIESQAAHLLSLEGQTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTL      1 - 70
LQEYGLLQRRLENVENLLHNRNFWILRLPPGSKGESPKTTPSPSPRSSPRLNKGRSPATGAALTPRFQMF     71 - 140
LWTPVQMQKLRPSRD                                                           141 - 155
//

Text Mined References (9)

PMID Year Title
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.