Property Summary

NCBI Gene PubMed Count 21
PubMed Score 15.11
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 6.0e-04
Breast cancer 1.100 2.1e-07
Chronic Lymphocytic Leukemia 1.162 1.0e-02
lung cancer -1.200 3.6e-02
malignant mesothelioma 1.200 1.1e-06
medulloblastoma, large-cell -1.200 6.8e-03
Multiple myeloma 1.413 1.5e-03
ovarian cancer -2.000 1.4e-06
pancreatic ductal adenocarcinoma liver m... -1.177 3.0e-02
subependymal giant cell astrocytoma -1.347 1.9e-02
Waldenstrons macroglobulinemia 1.329 2.5e-02

Gene RIF (5)

AA Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELA      1 - 70
GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA                 71 - 128
//

Text Mined References (21)

PMID Year Title