Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.98
PubTator Score 7.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 2.08020449489119E-7
malignant mesothelioma 3163 1.07969213230805E-6
ovarian cancer 8492 1.4483269175106E-6
atypical teratoid / rhabdoid tumor 4369 6.02640997369946E-4
Multiple myeloma 1328 0.00145395600071692
medulloblastoma, large-cell 6234 0.00682149047656515
chronic lymphocytic leukemia 244 0.0102153075121947
subependymal giant cell astrocytoma 2287 0.018589770926254
Waldenstrons macroglobulinemia 765 0.0253729645604727
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0298288646082995
lung cancer 4473 0.0364745105319583

Expression

Synonym

Accession Q71UI9 A6NFA8 A6NKY0 A6NN01 A8MQC5 Q59GV8 Q6PK98
Symbols H2AV
H2A.Z-2

Gene

PDB

3WAA  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

 GO Function (1)

 GO Process (1)

Gene RIF (5)

PMID Text
24311584 A mutational analysis revealed that the amino-acid difference at position 38 is at least partially responsible for the structural polymorphism in the L1 loop region of H2A.Z.1 and H2A.Z.2.
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELA      1 - 70
GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA                 71 - 128
//

Text Mined References (21)

PMID Year Title
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
24311584 2013 Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20299344 2010 Identification and characterization of the two isoforms of the vertebrate H2A.Z histone variant.
20003410 2009 Characterization of the histone H2A.Z-1 and H2A.Z-2 isoforms in vertebrates.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...