Property Summary

NCBI Gene PubMed Count 21
Grant Count 22
R01 Count 9
Funding $2,463,588.46
PubMed Score 13.98
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GO Process (1)

Gene RIF (5)

PMID Text
24311584 A mutational analysis revealed that the amino-acid difference at position 38 is at least partially responsible for the structural polymorphism in the L1 loop region of H2A.Z.1 and H2A.Z.2.
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELA      1 - 70
GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA                 71 - 128
//

Text Mined References (21)

PMID Year Title
25731851 2015 Nucleosome adaptability conferred by sequence and structural variations in histone H2A-H2B dimers.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
24311584 2013 Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20299344 2010 Identification and characterization of the two isoforms of the vertebrate H2A.Z histone variant.
20003410 2009 Characterization of the histone H2A.Z-1 and H2A.Z-2 isoforms in vertebrates.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...