Knowledge Summary

Patent

No data available

AA Sequence

MSSCPVHDCPSWDPERLEPVETGSRGALRLRGGAPGSAAGFRASIWGPAGYPSPVGLGHPASLPRPAYSP      1 - 70
RCPEPDARHGWGSGSNAGYRGPDRAGRTPCPAQDREGRSSSPVPPPRLKAMTSQARKQNGGALIDTVDWT     71 - 140
REAPDSDPVMSMQKTQKPQTTVGQ                                                  141 - 164
//