Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.41
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Pulmonary tuberculosis 5 3.206 1.6

Expression

Synonym

Accession Q71DI3 A2BDF6 A6NFS4 Q6B053
Symbols

Gene

PDB

4MZF   4MZG   4MZH   5BO0   3AV1   5B0Y   5B0Z   5B40   3DB3   2X4W   2X4X   2X4Y   3MO8   5CIU   4OUC   2IIJ   3QO2   3R93  

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
23415232 2013 Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer.
22483618 2012 Lysyl oxidase-like 2 deaminates lysine 4 in histone H3.
22387026 2012 Histone H3 lysine 56 methylation regulates DNA replication through its interaction with PCNA.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21636898 2011 Structures of human nucleosomes containing major histone H3 variants.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21596426 2011 Recognition of a mononucleosomal histone modification pattern by BPTF via multivalent interactions.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
More...