Property Summary

NCBI Gene PubMed Count 43
PubMed Score 47.85
PubTator Score 25.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q70YC5 A8K0F0 O94930 Q05D75 Q5HYE6 Q68SG8 Q6NSK2 Q6P9D4 Q70YC6 Q70YC7
Symbols UAN
Su48
ZNF365D

Gene

Gene RIF (18)

PMID Text
27333658 It regulates cortical cell positioning and neurite extension by sustaining the anterograde transport of Lis1/DISC1 through control of Ndel1 phosphorylation
26287344 The SNP rs10995251 in ZNF365 gene is associated with the susceptibility to bronchial asthma in children.
25705664 we discuss the expression of DISC1, DBZ, and SGK1 , their roles in the regulation of oligodendrocyte function, possible interactions of DISC1 and DBZ in relation to SZ, and the activation of the SGK1 signaling cascade in relation to MDD.
25489960 Single-nucleotide polymorphism in ZNF365 gene is associated with Crohn's disease.
25060549 We evaluated the association of polymorphisms of ZNF365 gene with the metabolic disorders in children with urolithiasis
23966166 These results suggest an homologous recombination repair-dependent function of ZNF365 in preventing genomic instability.
23776040 In the absence of ZNF365, defective telomeres engage in aberrant recombination of telomere ends, leading to increased telomere sister chromatid exchange and formation of anaphase DNA bridges, including ultra-fine DNA bridges, and ultimately increased cytokinesis failure and aneuploidy
23593153 Our findings suggest that RAB3GAP1 and ZNF365 are relevant candidate genes for SCD and will contribute to the mechanistic understanding of SCD susceptibility.
22351618 Common variants at the 19p13.1 and ZNF365 loci are associated with ER subtypes of breast cancer and ovarian cancer risk in BRCA1 and BRCA2 mutation carriers.
21257989 the non-synonymous Ala62Thr SNP, rs7076156, underlies the association between 10q21 and CD risk and suggest that this SNP acts by altering expression of genes under the control of ZNF365 isoform D.
More...

AA Sequence

MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKD      1 - 70
TDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVSYVQTYTAMDLHADSLD     71 - 140
GTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQE    141 - 210
VQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQ    211 - 280
RVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKA    281 - 350
KDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII                 351 - 407
//

Text Mined References (45)

PMID Year Title
27333658 2016 [When we have learned about the brain development from a disease-oriented study: DBZ regulates cortical cell positioning and neurite extension by sustaining the anterograde transport of Lis1/DISC1 through control of Ndel1 phosphorylation].
26287344 2015 [Association between ZNF365 gene polymorphisms and bronchial asthma in children].
25705664 2015 Disturbance of oligodendrocyte function plays a key role in the pathogenesis of schizophrenia and major depressive disorder.
25534755 2015 A genome-wide association study of autism using the Simons Simplex Collection: Does reducing phenotypic heterogeneity in autism increase genetic homogeneity?
25489960 2015 Immunochip analysis identification of 6 additional susceptibility loci for Crohn's disease in Koreans.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
25108386 2014 Genome-wide association analysis of Vogt-Koyanagi-Harada syndrome identifies two new susceptibility loci at 1p31.2 and 10q21.3.
25060549 2014 Metabolic abnormalities and polymorphisms of the vitamin D receptor (VDR) and ZNF365 genes in children with urolithiasis.
24204295 2013 Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic.
23966166 2013 ZNF365 promotes stalled replication forks recovery to maintain genome stability.
More...