Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.37
PubTator Score 5.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.498 9.1e-03
cutaneous lupus erythematosus 1.300 8.4e-03
interstitial cystitis -1.800 5.3e-03
lung adenocarcinoma -2.100 3.2e-14
mucosa-associated lymphoid tissue lympho... -1.486 2.1e-02
non-small cell lung cancer -1.427 6.5e-18
osteosarcoma -1.978 2.4e-05
ovarian cancer 4.900 3.9e-10

Gene RIF (1)

AA Sequence

MLTEVMEVWHGLVIAVVSLFLQACFLTAINYLLSRHMAHKSEQILKAASLQVPRPSPGHHHPPAVKEMKE      1 - 70
TQTERDIPMSDSLYRHDSDTPSDSLDSSCSSPPACQATEDVDYTQVVFSDPGELKNDSPLDYENIKEITD     71 - 140
YVNVNPERHKPSFWYFVNPALSEPAEYDQVAM                                          141 - 172
//

Text Mined References (5)

PMID Year Title