Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 3.0e-53
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 7.600 3.0e-53

AA Sequence

MAKRLQAELSCPVCLDFFSCSISLSCTHVFCFDCIQRYILENHDFRAMCPLCRDVVKVPALEEWQVSVLT      1 - 70
LMTKQHNSRLEQSLHVREELRHFREDVTLDAATASSLLVFSNDLRSAQCKKIHHDLTKDPRLACVLGTPC     71 - 140
FSSGQHYWEVEVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPASPRLRRVGIF    141 - 210
LDADLEEIQFFDVDNNVLIYTHDGFFSLELLCPFFCLELLGEGESGNVLTICP                     211 - 263
//

Text Mined References (3)

PMID Year Title