Property Summary

NCBI Gene PubMed Count 3
PubMed Score 42.22
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.18597014574173E-7
ovarian cancer 8492 1.17234971240407E-6
osteosarcoma 7933 1.78903154962874E-5
adult high grade glioma 2148 2.09943554501051E-5
glioblastoma 5572 3.99383633475321E-5
psoriasis 6685 6.2786779807352E-4

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.500 0.001
osteosarcoma 2.210 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
adult high grade glioma 1.200 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q6ZW31 Q7L2I8 Q8N6J2 Q9H8K4
Symbols 7h3
SYD1

Gene

PANTHER Protein Class (2)

  Ortholog (8)

AA Sequence

MAEPLLRKTFSRLRGREKLPRKKSDAKERGHPAQRPEPSPPEPEPQAPEGSQAGAEGPSSPEASRSPARG      1 - 70
AYLQSLEPSSRRWVLGGAKPAEDTSLGPGVPGTGEPAGEIWYNPIPEEDPRPPAPEPPGPQPGSAESEGL     71 - 140
APQGAAPASPPTKASRTKSPGPARRLSIKMKKLPELRRRLSLRGPRAGRERERAAPAGSVISRYHLDSSV    141 - 210
GGPGPAAGPGGTRSPRAGYLSDGDSPERPAGPPSPTSFRPYEVGPAARAPPAALWGRLSLHLYGLGGLRP    211 - 280
APGATPRDLCCLLQVDGEARARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGT    281 - 350
VLLPTVFRGCQAQQLAVRLEPQGLLYAKLTLSEQQEAPATAEPRVFGLPLPLLVERERPPGQVPLIIQKC    351 - 420
VGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQP    421 - 490
LYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPV    491 - 560
LLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWPDPRLPRQSPDVAPYLRPKRQPPLHLPLAD    561 - 630
PEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFE    631 - 700
DDFDAPFNPHLNLKDFDALILDLERELSKQINVCL                                       701 - 735
//

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23791195 2013 mSYD1A, a mammalian synapse-defective-1 protein, regulates synaptogenic signaling and vesicle docking.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.