Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.100 0.004
oligodendroglioma -1.200 0.001
glioblastoma -2.500 0.000
medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -3.200 0.000
adult high grade glioma -2.100 0.001
pilocytic astrocytoma -1.100 0.013
psoriasis -1.500 0.000

AA Sequence

MNLLYRKTKLEWRQHKEEEAKRSSSKEVAPAGSAGPAAGQGPGVRVRDIASLRRSLRMGFMTMPASQEHT      1 - 70
PHPCRSAMAPRSLSCHSVGSMDSVGGGPGGASGGLTEDSSTRRPPAKPRRHPSTKLSMVGPGSGAETPPS     71 - 140
KKAGSQKPTPEGRESSRKVPPQKPRRSPNTQLSVSFDESCPPGPSPRGGNLPLQRLTRGSRVAGDPDVGA    141 - 210
QEEPVYIEMVGDVFRGGGRSGGGLAGPPLGGGGPTPPAGADSDSEESEAIYEEMKYPLPEEAGEGRANGP    211 - 280
PPLTATSPPQQPHALPPHAHRRPASALPSRRDGTPTKTTPCEIPPPFPNLLQHRPPLLAFPQAKSASRTP    281 - 350
GDGVSRLPVLCHSKEPAGSTPAPQVPARERETPPPPPPPPAANLLLLGPSGRARSHSTPLPPQGSGQPRG    351 - 420
ERELPNSHSMICPKAAGAPAAPPAPAALLPGPPKDKAVSYTMVYSAVKVTTHSVLPAGPPLGAGEPKTEK    421 - 490
EISVLHGMLCTSSRPPVPGKTSPHGGAMGAAAGVLHHRGCLASPHSLPDPTVGPLTPLWTYPATAAGLKR    491 - 560
PPAYESLKAGGVLNKGCGVGAPSPMVKIQLQEQGTDGGAFASISCAHVIASAGTPEEEEEEVGAATFGAG    561 - 630
WALQRKVLYGGRKAKELDKVEDGARAWNGSAEGPGKVEREDRGPGTSGIPVRSQGAEGLLARIHHGDRGG    631 - 700
SRTALPIPCQTFPACHRNGDFTGGYRLGRSASTSGVRQVVLHTPRPCSQPRDALSQPHPALPLPLPLPPQ    701 - 770
PARERDGKLLEVIERKRCVCKEIKARHRPDRGLCKQESMPILPSWRRGPEPRKSGTPPCRRQHTVLWDTA    771 - 840
I//

Text Mined References (5)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
21946561 2011 NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.