Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.100 6.1e-04
Astrocytoma, Pilocytic -1.100 1.5e-02
atypical teratoid / rhabdoid tumor -3.000 1.6e-10
ependymoma -1.100 4.4e-03
glioblastoma -1.400 1.4e-04
group 3 medulloblastoma -1.600 4.4e-02
medulloblastoma, large-cell -3.200 2.1e-06
oligodendroglioma -1.200 1.5e-03
psoriasis -1.500 1.9e-47

Synonym

Accession Q6ZVC0 Q6U9Y3 Q8N1V0
Symbols C7orf51

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNLLYRKTKLEWRQHKEEEAKRSSSKEVAPAGSAGPAAGQGPGVRVRDIASLRRSLRMGFMTMPASQEHT      1 - 70
PHPCRSAMAPRSLSCHSVGSMDSVGGGPGGASGGLTEDSSTRRPPAKPRRHPSTKLSMVGPGSGAETPPS     71 - 140
KKAGSQKPTPEGRESSRKVPPQKPRRSPNTQLSVSFDESCPPGPSPRGGNLPLQRLTRGSRVAGDPDVGA    141 - 210
QEEPVYIEMVGDVFRGGGRSGGGLAGPPLGGGGPTPPAGADSDSEESEAIYEEMKYPLPEEAGEGRANGP    211 - 280
PPLTATSPPQQPHALPPHAHRRPASALPSRRDGTPTKTTPCEIPPPFPNLLQHRPPLLAFPQAKSASRTP    281 - 350
GDGVSRLPVLCHSKEPAGSTPAPQVPARERETPPPPPPPPAANLLLLGPSGRARSHSTPLPPQGSGQPRG    351 - 420
ERELPNSHSMICPKAAGAPAAPPAPAALLPGPPKDKAVSYTMVYSAVKVTTHSVLPAGPPLGAGEPKTEK    421 - 490
EISVLHGMLCTSSRPPVPGKTSPHGGAMGAAAGVLHHRGCLASPHSLPDPTVGPLTPLWTYPATAAGLKR    491 - 560
PPAYESLKAGGVLNKGCGVGAPSPMVKIQLQEQGTDGGAFASISCAHVIASAGTPEEEEEEVGAATFGAG    561 - 630
WALQRKVLYGGRKAKELDKVEDGARAWNGSAEGPGKVEREDRGPGTSGIPVRSQGAEGLLARIHHGDRGG    631 - 700
SRTALPIPCQTFPACHRNGDFTGGYRLGRSASTSGVRQVVLHTPRPCSQPRDALSQPHPALPLPLPLPPQ    701 - 770
PARERDGKLLEVIERKRCVCKEIKARHRPDRGLCKQESMPILPSWRRGPEPRKSGTPPCRRQHTVLWDTA    771 - 840
I//

Text Mined References (5)

PMID Year Title