Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.53
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.600 6.4e-07
atypical teratoid / rhabdoid tumor 1.200 2.7e-03
ductal carcinoma in situ 1.300 3.2e-03
ependymoma 1.400 6.0e-05
gastric cancer -1.100 3.9e-03
group 4 medulloblastoma 1.600 2.3e-03
intraductal papillary-mucinous carcinoma... 1.300 4.7e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.0e-03
invasive ductal carcinoma 1.500 4.5e-03
non-small cell lung cancer 1.191 1.9e-10
osteosarcoma 1.515 7.0e-06
pancreatic cancer 1.400 1.6e-07
spina bifida -1.342 1.5e-02
tuberculosis 1.100 7.3e-05

Gene RIF (2)

AA Sequence

MTSAAEIKKPPVAPKPKFVVANNKPAPPPIAPKPDIVISSVPQSTKKMKPAIAPKPKVLKTSPVREIGQS      1 - 70
PSRKIMLNLEGHKQELAESTDNFNCKYEGNQSNDYISPMCSCSSECIHKLGHRENLCVKQLVLEPLEMNE     71 - 140
NLENSKIDETLTIKTRSKCDLYGEKAKNQGGVVLKASVLEEELKDALIHQMPPFISAQKHRPTDSPEMNG    141 - 210
GCNSNGQFRIEFADLSPSPSSFEKVPDHHSCHLQLPSDECEHFETCQDDSEKSNNCFQSSELEALENGKR    211 - 280
STLISSDGVSKKSEVKDLGPLEIHLVPYTPKFPTPKPRKTRTARLLRQKCVDTPSESTEEPGNSDSSSSC    281 - 350
LTENSLKINKISVLHQNVLCKQEQVDKMKLGNKSELNMESNSDAQDLVNSQKAMCNETTSFEKMAPSFDK    351 - 420
DSNLSSDSTTVDGSSMSLAVDEGTGFIRCTVSMSLPKQLKLTCNEHLQSGRNLGVSAPQMQKESVIKEEN    421 - 490
SLRIVPKKPQRHSLPATGVLKKAASEELLEKSSYPSSEEKSSEKSLERNHLQHLCAQNRGVSSSFDMPKR    491 - 560
ASEKPVWKLPHPILPFSGNPEFLKSVTVSSNSEPSTALTKPRAKSLSAMDVEKCTKPCKDSTKKNSFKKL    561 - 630
LSMKLSICFMKSDFQKFWSKSSQLGDTTTGHLSSGEQKGIESDWQGLLVGEEKRSKPIKAYSTENYSLES    631 - 700
QKKRKKSRGQTSAANGLRAESLDDQMLSRESSSQAPYKSVTSLCAPEYENIRHYEEIPEYENLPFIMAIR    701 - 770
KTQELEWQNSSSMEDADANVYEVEEPYEAPDGQLQLGPRHQHSSSGASQEEQNDLGLGDLPSDEEEIINS    771 - 840
SDEDDVSSESSKGEPDPLEDKQDEDNGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQLGK    841 - 910
PVIEDRILNQILYYLPQLYELNRDLLKELEERMLHWTEQQRIADIFVKKGPYLKMYSTYIKEFDKNIALL    911 - 980
DEQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNLIEDAGDYRDTQDALAVV    981 - 1050
IEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTT   1051 - 1120
PVQSGMYKLNNMLSLAGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRI   1121 - 1190
TFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKY   1191 - 1260
GLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSAN   1261 - 1330
TEDSSMSGYLYRSKGNKKPWKHFWFVIKNKVLYTYAASEDVAALESQPLLGFTVIQVKDENSESKVFQLL   1331 - 1400
HKNMLFYVFKAEDAHSAQKWIEAFQEGTIL                                           1401 - 1430
//

Text Mined References (13)

PMID Year Title