Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.92
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 9.7567915695137E-14
pancreatic cancer 2300 5.24628097203841E-8
malignant mesothelioma 3163 6.38271634073036E-7
posterior fossa group B ependymoma 1530 1.41543867036154E-5
osteosarcoma 7933 2.40338236066205E-5
tuberculosis and treatment for 6 months 686 5.52177089227294E-5
medulloblastoma 1524 0.0014508462177651
atypical teratoid / rhabdoid tumor 4369 0.00265952352135467
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00304528425458711
ductal carcinoma in situ 1745 0.00320300683352916
gastric cancer 436 0.00389412044223251
invasive ductal carcinoma 2950 0.00445537809233264
spina bifida 1064 0.0145046263059755
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0467039190400347
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Pathway (1)

Gene RIF (1)

PMID Text
18187620 Knockdown of FYVE, RhoGEF and PH domain containing 6 (FGD6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MTSAAEIKKPPVAPKPKFVVANNKPAPPPIAPKPDIVISSVPQSTKKMKPAIAPKPKVLKTSPVREIGQS      1 - 70
PSRKIMLNLEGHKQELAESTDNFNCKYEGNQSNDYISPMCSCSSECIHKLGHRENLCVKQLVLEPLEMNE     71 - 140
NLENSKIDETLTIKTRSKCDLYGEKAKNQGGVVLKASVLEEELKDALIHQMPPFISAQKHRPTDSPEMNG    141 - 210
GCNSNGQFRIEFADLSPSPSSFEKVPDHHSCHLQLPSDECEHFETCQDDSEKSNNCFQSSELEALENGKR    211 - 280
STLISSDGVSKKSEVKDLGPLEIHLVPYTPKFPTPKPRKTRTARLLRQKCVDTPSESTEEPGNSDSSSSC    281 - 350
LTENSLKINKISVLHQNVLCKQEQVDKMKLGNKSELNMESNSDAQDLVNSQKAMCNETTSFEKMAPSFDK    351 - 420
DSNLSSDSTTVDGSSMSLAVDEGTGFIRCTVSMSLPKQLKLTCNEHLQSGRNLGVSAPQMQKESVIKEEN    421 - 490
SLRIVPKKPQRHSLPATGVLKKAASEELLEKSSYPSSEEKSSEKSLERNHLQHLCAQNRGVSSSFDMPKR    491 - 560
ASEKPVWKLPHPILPFSGNPEFLKSVTVSSNSEPSTALTKPRAKSLSAMDVEKCTKPCKDSTKKNSFKKL    561 - 630
LSMKLSICFMKSDFQKFWSKSSQLGDTTTGHLSSGEQKGIESDWQGLLVGEEKRSKPIKAYSTENYSLES    631 - 700
QKKRKKSRGQTSAANGLRAESLDDQMLSRESSSQAPYKSVTSLCAPEYENIRHYEEIPEYENLPFIMAIR    701 - 770
KTQELEWQNSSSMEDADANVYEVEEPYEAPDGQLQLGPRHQHSSSGASQEEQNDLGLGDLPSDEEEIINS    771 - 840
SDEDDVSSESSKGEPDPLEDKQDEDNGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQLGK    841 - 910
PVIEDRILNQILYYLPQLYELNRDLLKELEERMLHWTEQQRIADIFVKKGPYLKMYSTYIKEFDKNIALL    911 - 980
DEQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNLIEDAGDYRDTQDALAVV    981 - 1050
IEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTT   1051 - 1120
PVQSGMYKLNNMLSLAGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRI   1121 - 1190
TFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKY   1191 - 1260
GLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSAN   1261 - 1330
TEDSSMSGYLYRSKGNKKPWKHFWFVIKNKVLYTYAASEDVAALESQPLLGFTVIQVKDENSESKVFQLL   1331 - 1400
HKNMLFYVFKAEDAHSAQKWIEAFQEGTIL                                           1401 - 1430
//

Text Mined References (12)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...