Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 4.1e-05
ependymoma -1.400 7.2e-07
glioblastoma -1.300 3.0e-02
group 3 medulloblastoma -1.300 2.8e-02
medulloblastoma, large-cell -2.200 5.2e-04
non primary Sjogren syndrome sicca -1.300 2.2e-02
oligodendroglioma -1.400 1.7e-02
osteosarcoma -1.009 6.4e-03
primitive neuroectodermal tumor -1.900 1.0e-03

AA Sequence

MDTKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAEARGATAGASACQGGLYGGVA      1 - 70
GVAYMLYHVSQSPLFATARERYLRSAKRLIDACARAEEWGEPDADTRAAFLLGGAGVYAVATLVYHALGR     71 - 140
SDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGK    141 - 210
QYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSDRELVWQSVDFLMEQEQNCNWPPEL    211 - 280
GETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVF    281 - 350
LLLYRLTGNSKYIYRAQRFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV    351 - 420
//

Text Mined References (5)

PMID Year Title