Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma -1.400 0.017
osteosarcoma -1.009 0.006
ependymoma -1.400 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.030
medulloblastoma, large-cell -2.200 0.001
primitive neuroectodermal tumor -1.900 0.001
non primary Sjogren syndrome sicca -1.300 0.022

AA Sequence

MDTKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAEARGATAGASACQGGLYGGVA      1 - 70
GVAYMLYHVSQSPLFATARERYLRSAKRLIDACARAEEWGEPDADTRAAFLLGGAGVYAVATLVYHALGR     71 - 140
SDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGK    141 - 210
QYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSDRELVWQSVDFLMEQEQNCNWPPEL    211 - 280
GETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVF    281 - 350
LLLYRLTGNSKYIYRAQRFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV    351 - 420
//

Text Mined References (5)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10409428 1999 Gene expression in proliferating human erythroid cells.