Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma 1524 1.5282936972378E-7
ependymoma 2514 7.21234976306204E-7
atypical teratoid / rhabdoid tumor 4369 4.08270159016203E-5
medulloblastoma, large-cell 6234 5.20968954340358E-4
primitive neuroectodermal tumor 3031 0.0010438328951466
osteosarcoma 7933 0.00636820796867667
oligodendroglioma 2849 0.0165871958646239
non primary Sjogren syndrome sicca 840 0.0216756744280872
glioblastoma 5572 0.0296198632906841

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma -1.400 0.017
osteosarcoma -1.009 0.006
ependymoma -1.400 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.030
medulloblastoma, large-cell -2.200 0.001
primitive neuroectodermal tumor -1.900 0.001
non primary Sjogren syndrome sicca -1.300 0.022

Synonym

Accession Q6ZV70 A6NHE3
Symbols

Gene

  Ortholog (11)

AA Sequence

MDTKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAEARGATAGASACQGGLYGGVA      1 - 70
GVAYMLYHVSQSPLFATARERYLRSAKRLIDACARAEEWGEPDADTRAAFLLGGAGVYAVATLVYHALGR     71 - 140
SDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGK    141 - 210
QYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSDRELVWQSVDFLMEQEQNCNWPPEL    211 - 280
GETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVF    281 - 350
LLLYRLTGNSKYIYRAQRFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV    351 - 420
//

Text Mined References (5)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10409428 1999 Gene expression in proliferating human erythroid cells.