Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

AA Sequence

MCTVDVEGFDDVGETLSDAVRDGLGTILRGGAEEGSYDNWPHTRKSWGPLSPGHQRELWTQPDPWTEVLS      1 - 70
GHKGDAGACGCCCFCSQFINARCAHPLCLARGLDRRASEEMPILQALCLLPKVSTRSITVPSPQRSAPRA     71 - 140
SLCPPHKGKSP                                                               141 - 151
//

Text Mined References (9)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.