Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.99
PubTator Score 0.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 7.0e-11
gastric carcinoma 1.100 1.6e-02
glioblastoma 1.200 1.3e-06
lung carcinoma -2.000 6.8e-24
pediatric high grade glioma 1.200 1.5e-04
psoriasis -1.100 9.1e-04
sonic hedgehog group medulloblastoma 1.400 3.8e-06
subependymal giant cell astrocytoma 1.558 1.7e-02
tuberculosis -2.400 2.5e-06

Protein-protein Interaction (11)

Gene RIF (3)

AA Sequence

MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRN      1 - 70
PGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQ     71 - 140
GIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATS    141 - 210
SDKVQEEIEEGKNLICLL                                                        211 - 228
//

Text Mined References (13)

PMID Year Title