Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.99
PubTator Score 0.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 0.001
glioblastoma 2.000 0.000
tuberculosis -2.400 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.600 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
subependymal giant cell astrocytoma 1.558 0.017
lung carcinoma -2.000 0.000
gastric carcinoma 1.100 0.016

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15905332 The authors present an overview of the LHFP gene family in mouse and humans

AA Sequence

MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRN      1 - 70
PGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQ     71 - 140
GIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATS    141 - 210
SDKVQEEIEEGKNLICLL                                                        211 - 228
//

Text Mined References (12)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10329012 1999 LHFP, a novel translocation partner gene of HMGIC in a lipoma, is a member of a new family of LHFP-like genes.
More...