Knowledge Summary

Patent

No data available

AA Sequence

MIKEAGAIISTRHCNPQNGDRCVAALARVECTHFLWPMCIGEVAHVSAEITYTSKHSVEVQVNMMSENIL      1 - 70
TGAKKLTNKATLWYAPLSLTNVDKVLEEPPVVYFRQEQEEEGQKRYKTQKLERMETNWRNGDIVQPVLNP     71 - 140
EPNTVSYSQSSLIHLVGPSDCTLHSFVHEGVTMKVMDEVAGILAARHCKTNLVTASMEAINFDNKIRKGC    141 - 210
IKTISGRMTFTSNKSVEIEVLVDADCVVDSSQKRYRAASVFT                                211 - 252
//

Text Mined References (2)

PMID Year Title
16423998 2006 A functional variant in the transcriptional regulatory region of gene LOC344967 cosegregates with disease phenotype in familial nasopharyngeal carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.