Knowledge Summary

Patent

No data available

AA Sequence

MIKEAGAIISTRHCNPQNGDRCVAALARVECTHFLWPMCIGEVAHVSAEITYTSKHSVEVQVNMMSENIL      1 - 70
TGAKKLTNKATLWYAPLSLTNVDKVLEEPPVVYFRQEQEEEGQKRYKTQKLERMETNWRNGDIVQPVLNP     71 - 140
EPNTVSYSQSSLIHLVGPSDCTLHSFVHEGVTMKVMDEVAGILAARHCKTNLVTASMEAINFDNKIRKGC    141 - 210
IKTISGRMTFTSNKSVEIEVLVDADCVVDSSQKRYRAASVFT                                211 - 252
//

Text Mined References (2)

PMID Year Title