Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZUU3 A6NGX0
Symbols C3orf72

Gene

AA Sequence

MTRTPVGSARTRPKPRKLGPQRGKALQASSRLSESPALVKKRMPDACTLGRAGIGLPKMCLHMAVRHSKA      1 - 70
QKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEAGSASLEPLSSSRAAAGCLNQVPLSPFLAGPRNTRR     71 - 140
LPAPERERIELAATLCLEGWPLRCLASKGKLHCVY                                       141 - 175
//

Text Mined References (2)

PMID Year Title