Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MISCAEQRSRQGEAGRGPAPVAPAFLPLWLPRGCSGILSVPAVAMHSAGTPRAESPMSRQEKDAELDRRI      1 - 70
VALRKKNQALLRRYQEIQEDRRQAEQGGMAVTTPALLQPDGLTVTISQVPGEKRVVSRNWARGTCGPRVT     71 - 140
NEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSEKPTRARNQGIEGSPGGRVTRSPPTQVAISS    141 - 210
DSARKGSWEPWSRPVGEPPEAGWDYAQWKQEREQIDLARLARHRDAQGDWRRPWDLDKAKSTLQDCSQLR    211 - 280
GEGPARAGSRRGPRSHQKLQPPPLLPDGKGRGGQASRPSVAPATGSKARGKERLTGRARRWDMKEDKEEL    281 - 350
EGQEGSQSTRETPSEEEQAQKQSGMEQGRLGSAPAASPALASPEGPKGESVASTASSVPCSPQEPDLAPL    351 - 420
DLSLGGAGIPGPRESGCVLGLRPGAQESPVSWPEGSKQQPLGWSNHQAELEVQTCPEPQRGAGLPEPGED    421 - 490
RSGKSGAQQGLAPRSRPTRGGSQRSRGTAGVRRRTGRPGPAGRC                              491 - 534
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...