Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.46
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Synonym

Accession Q6ZUT6 B9EIQ8 Q68DG9 Q6ZTM3 Q6ZU22
Symbols C15orf52

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

AA Sequence

MISCAEQRSRQGEAGRGPAPVAPAFLPLWLPRGCSGILSVPAVAMHSAGTPRAESPMSRQEKDAELDRRI      1 - 70
VALRKKNQALLRRYQEIQEDRRQAEQGGMAVTTPALLQPDGLTVTISQVPGEKRVVSRNWARGTCGPRVT     71 - 140
NEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSEKPTRARNQGIEGSPGGRVTRSPPTQVAISS    141 - 210
DSARKGSWEPWSRPVGEPPEAGWDYAQWKQEREQIDLARLARHRDAQGDWRRPWDLDKAKSTLQDCSQLR    211 - 280
GEGPARAGSRRGPRSHQKLQPPPLLPDGKGRGGQASRPSVAPATGSKARGKERLTGRARRWDMKEDKEEL    281 - 350
EGQEGSQSTRETPSEEEQAQKQSGMEQGRLGSAPAASPALASPEGPKGESVASTASSVPCSPQEPDLAPL    351 - 420
DLSLGGAGIPGPRESGCVLGLRPGAQESPVSWPEGSKQQPLGWSNHQAELEVQTCPEPQRGAGLPEPGED    421 - 490
RSGKSGAQQGLAPRSRPTRGGSQRSRGTAGVRRRTGRPGPAGRC                              491 - 534
//

Text Mined References (13)

PMID Year Title