Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 0.013
ependymoma -1.800 0.019
oligodendroglioma -1.500 0.024
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma -1.900 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.100 0.011
tuberculosis 1.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.001
pediatric high grade glioma -1.300 0.000
primary Sjogren syndrome -1.100 0.019

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17457313 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKL      1 - 70
LRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERL     71 - 140
NQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKSSSSAL    141 - 210
TGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKL    211 - 280
RTLEVSGLWSLPGGKDTILFSDPTLPSGQRSRSPLLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALT    281 - 350
APEDAGRPAVNSPANQSRGNQCKLFHPSLPQLPSEEEVNSLGREIIKLTKEQAAAELEEVRRESPIEGQR    351 - 420
SETGPAPPGLAIQGELPKSHLDSFEASRPAAKASTPEDGKGIPEGGGMRSTVKT                    421 - 474
//

Text Mined References (11)

PMID Year Title
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17457313 2007 Association analysis of the chromosome 4p15-p16 candidate region for bipolar disorder and schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...