Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.92378568979949E-8
glioblastoma 5572 1.92192317009658E-5
tuberculosis 1563 3.20098309704239E-5
medulloblastoma, large-cell 6234 4.20064308458664E-5
medulloblastoma 1524 4.3321869797755E-5
pediatric high grade glioma 2712 4.07725187330466E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.00276039364476E-4
primitive neuroectodermal tumor 3031 0.0111929935035862
astrocytic glioma 2241 0.0129576204396939
ependymoma 2514 0.0186343026719837
primary Sjogren syndrome 789 0.0187550888004779
oligodendroglioma 2849 0.0237766708700512
Disease Target Count Z-score Confidence
cone-rod dystrophy 60 3.808 1.9

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 0.013
ependymoma -1.800 0.019
oligodendroglioma -1.500 0.024
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
glioblastoma -1.900 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.100 0.011
tuberculosis 1.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.001
pediatric high grade glioma -1.300 0.000
primary Sjogren syndrome -1.100 0.019

Synonym

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17457313 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKL      1 - 70
LRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERL     71 - 140
NQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKSSSSAL    141 - 210
TGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKL    211 - 280
RTLEVSGLWSLPGGKDTILFSDPTLPSGQRSRSPLLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALT    281 - 350
APEDAGRPAVNSPANQSRGNQCKLFHPSLPQLPSEEEVNSLGREIIKLTKEQAAAELEEVRRESPIEGQR    351 - 420
SETGPAPPGLAIQGELPKSHLDSFEASRPAAKASTPEDGKGIPEGGGMRSTVKT                    421 - 474
//

Text Mined References (11)

PMID Year Title
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17457313 2007 Association analysis of the chromosome 4p15-p16 candidate region for bipolar disorder and schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...