Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.21
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.5434691041588E-8
osteosarcoma 7933 1.2424582559147E-6
psoriasis 6685 0.00169455511245108
primitive neuroectodermal tumor 3031 0.00190945792945658

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 0.002
osteosarcoma -1.592 0.000
posterior fossa group B ependymoma 2.000 0.000
primitive neuroectodermal tumor 1.100 0.002

Synonym

Accession Q6ZUS5 B3KW66 J3KQZ8 Q9H8G6
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Dog OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIER      1 - 70
RRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKEIQTLQEETKKVQAETASKTR     71 - 140
EVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLI    141 - 210
EQAQKLTATQSHLENRKQQLQQEQWYLESLIQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK      211 - 278
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.