Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.35
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 5.1e-10
osteosarcoma 7950 1.2e-06
psoriasis 6694 1.7e-03
primitive neuroectodermal tumor 3035 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Aggressive Periodontitis 12 3.554 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.400 5.1e-10
osteosarcoma -1.592 1.2e-06
primitive neuroectodermal tumor 1.100 1.9e-03
psoriasis -1.100 1.7e-03

AA Sequence

MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIER      1 - 70
RRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKEIQTLQEETKKVQAETASKTR     71 - 140
EVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLI    141 - 210
EQAQKLTATQSHLENRKQQLQQEQWYLESLIQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK      211 - 278
//

Text Mined References (9)

PMID Year Title