Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.20
PubTator Score 1.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 5.8e-12
fibroadenoma 559 6.7e-04
non primary Sjogren syndrome sicca 891 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Obesity 678 3.034 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.400 5.8e-12
fibroadenoma 1.400 6.7e-04
non primary Sjogren syndrome sicca -1.100 2.7e-02

Gene RIF (2)

AA Sequence

MEGLVFLNALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIF      1 - 70
LYLISIVPSLWLLELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTSRADDLIETAKVFVNNLSTVC     71 - 140
EKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRNSPALVYA    141 - 210
ILVIWTWSMLQFPLDLAVQNVVCPVSVTERGFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFK    211 - 280
VINQMLVFFAAKNFLVVVLQLYRLVVLALAVRASLRSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGL    281 - 350
AIPLRGSPVTSDDSHHTP                                                        351 - 368
//

Text Mined References (17)

PMID Year Title