Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.76
PubTator Score 1.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
fibroadenoma 1.400 0.001
non primary Sjogren syndrome sicca -1.100 0.027
Breast cancer -1.400 0.000

Gene RIF (2)

PMID Text
22986903 show novel expression of genes near regions of significantly associated SNPS, including TMEM26 and FOXA1 in airway epithelium and lung parenchyma, and ANK3 in alveolar macrophages in COPD
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGLVFLNALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIF      1 - 70
LYLISIVPSLWLLELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTSRADDLIETAKVFVNNLSTVC     71 - 140
EKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRNSPALVYA    141 - 210
ILVIWTWSMLQFPLDLAVQNVVCPVSVTERGFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFK    211 - 280
VINQMLVFFAAKNFLVVVLQLYRLVVLALAVRASLRSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGL    281 - 350
AIPLRGSPVTSDDSHHTP                                                        351 - 368
//

Text Mined References (17)

PMID Year Title
26211711 2015 Differential effects of Roux-en-Y gastric bypass surgery on brown and beige adipose tissue thermogenesis.
25706927 2015 Direct evidence of brown adipocytes in different fat depots in children.
25587357 2014 A multi-gene signature predicts outcome in patients with pancreatic ductal adenocarcinoma.
25534037 2015 BMP7 drives human adipogenic stem cells into metabolically active beige adipocytes.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23663743 2013 A classical brown adipose tissue mRNA signature partly overlaps with brite in the supraclavicular region of adult humans.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22986903 2013 Genome-wide study identifies two loci associated with lung function decline in mild to moderate COPD.
22529986 2012 Methylcap-seq reveals novel DNA methylation markers for the diagnosis and recurrence prediction of bladder cancer in a Chinese population.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
More...