Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.48
PubTator Score 14.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 1.117 1.7e-02
Astrocytoma, Pilocytic 1.200 2.2e-05
cystic fibrosis 1.700 1.3e-03
gastric carcinoma 1.800 2.9e-02
glioblastoma 1.100 5.9e-04
head and neck cancer and chronic obstruc... 1.400 3.9e-03
interstitial cystitis 1.500 4.0e-03
invasive ductal carcinoma 1.250 6.3e-03
lung carcinoma -1.600 1.3e-21
osteosarcoma -1.884 4.5e-03
ovarian cancer -1.100 4.8e-04
pancreatic ductal adenocarcinoma liver m... -1.383 1.6e-02
pediatric high grade glioma 1.100 3.1e-03
subependymal giant cell astrocytoma 2.253 9.4e-03

Gene RIF (4)

AA Sequence

MAASGVPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQKILTHRLGPEASFSAEDLSLFLSTRCVVVL      1 - 70
LSAELVQHFHKPALLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVKKA     71 - 140
ISEDSGCDSVTDTEPEDEKVVSYSKQQNLPTVTSPGNLMVVQPDRIRCGAETTVYVIVRCKLDDRVATEA    141 - 210
EFSPEDSPSVRMEAKVENEYTISVKAPNLSSGNVSLKIYSGDLVVCETVISYYTDMEEIGNLLSNAANPV    211 - 280
EFMCQAFKIVPYNTETLDKLLTESLKNNIPASGLHLFGINQLEEEDMMTNQRDEELPTLLHFAAKYGLKN    281 - 350
LTALLLTCPGALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKSHIKEELMHGEEADAVYE    351 - 420
SMAHLSTDLLMKCSLNPGCDEDLYESMAAFVPAATEDLYVEMLQASTSNPIPGDGFSRATKDSMIRKFLE    421 - 490
GNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAE    491 - 560
KSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFK    561 - 630
EWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRK    631 - 700
SVIPPRTELRRGDWKTDSTSSTASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPGPPQVDGTPT    701 - 770
MSLERPPRVPPRAASQRPPTRETFHPPPPVPPRGR                                       771 - 805
//

Text Mined References (20)

PMID Year Title