Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.43
PubTator Score 14.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.25652940232195E-21
cystic fibrosis 1670 2.47950050711699E-6
pilocytic astrocytoma 3086 1.54520980648152E-5
ulcerative colitis 2087 8.1720916668603E-5
ovarian cancer 8492 4.78249254350546E-4
interstitial cystitis 2299 0.00109526158851142
pediatric high grade glioma 2712 0.00305370267763277
head and neck cancer and chronic obstructive pulmonary disease 237 0.00385369133888969
osteosarcoma 7933 0.00451567194470871
invasive ductal carcinoma 2950 0.00628006371802743
glioblastoma 5572 0.00751893567715937
subependymal giant cell astrocytoma 2287 0.00935539973485166
pancreatic ductal adenocarcinoma liver metastasis 1795 0.015947263871455
gastric carcinoma 832 0.0293561591401874

Expression

  Differential Expression (14)

Synonym

Accession Q6ZUJ8 Q5TB56 Q5VXJ9 Q8N6J6 Q8NAC8
Symbols BCAP

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
20197460 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15893754 Abi-1 promotes Abl-mediated BCAP phosphorylation and suggest that Abi-1 in general coordinates kinase-substrate interactions

AA Sequence

MAASGVPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQKILTHRLGPEASFSAEDLSLFLSTRCVVVL      1 - 70
LSAELVQHFHKPALLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAHWQELTCDDEPETYVAAVKKA     71 - 140
ISEDSGCDSVTDTEPEDEKVVSYSKQQNLPTVTSPGNLMVVQPDRIRCGAETTVYVIVRCKLDDRVATEA    141 - 210
EFSPEDSPSVRMEAKVENEYTISVKAPNLSSGNVSLKIYSGDLVVCETVISYYTDMEEIGNLLSNAANPV    211 - 280
EFMCQAFKIVPYNTETLDKLLTESLKNNIPASGLHLFGINQLEEEDMMTNQRDEELPTLLHFAAKYGLKN    281 - 350
LTALLLTCPGALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKSHIKEELMHGEEADAVYE    351 - 420
SMAHLSTDLLMKCSLNPGCDEDLYESMAAFVPAATEDLYVEMLQASTSNPIPGDGFSRATKDSMIRKFLE    421 - 490
GNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAE    491 - 560
KSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFK    561 - 630
EWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRK    631 - 700
SVIPPRTELRRGDWKTDSTSSTASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPGPPQVDGTPT    701 - 770
MSLERPPRVPPRAASQRPPTRETFHPPPPVPPRGR                                       771 - 805
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24124408 2013 Genome-wide association study of orthostatic hypotension and supine-standing blood pressure changes in two korean populations.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20197460 2010 Pooled analysis of phosphatidylinositol 3-kinase pathway variants and risk of prostate cancer.
18337558 2008 Enhanced NK-cell development and function in BCAP-deficient mice.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
15893754 2005 Identification of B cell adaptor for PI3-kinase (BCAP) as an Abl interactor 1-regulated substrate of Abl kinases.
More...