Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q6ZUI0
Symbols FAM79B

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
19475631 Meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATR      1 - 70
PGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPL     71 - 140
SAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEIC    141 - 210
KLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF         211 - 275
//

Text Mined References (5)

PMID Year Title
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
19475631 2010 Non-replication of association for six polymorphisms from meta-analysis of genome-wide association studies of Parkinson's disease: large-scale collaborative study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.