Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dental caries 164 0.0 0.9

Synonym

Accession Q6ZUG5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPVYCKYQFHKTPVHKTKGEPHGTHVYFQDINVIFLGALHPSDLREYLEGPPMVVEVHDRDRKSEECSQK      1 - 70
PVLFGEDPLDSYLNFQALISPRETENNPFESQNKMWYPYGIAQVSFADLLLGHKYLNLAVPIHSCEVQPT     71 - 140
HCGQDSRRRKVVGLGVPRDGHQHGPMPRGNYLEADSQLKLRVDIAVPLRAGARAADPDLGGSQFGRIIFV    141 - 210
FDFKKVSLLHSLLQDITMINAKALGLDSYPVRTLQQILSAFKVRVRVQEQQHLDVLTGFHLLDGKTHLFI    211 - 280
LEGLADQGLRQLWENHQSWIPRSEHRKYKVLYNSQLLFRSRLYGDLEAILYHVHLFQPTELLLQQAVFFL    281 - 350
RDTERRRVFQALARIHDICYNSTTLWDVTVRDLLPSSAMIKDLSQEFGMPLSQEELTDEKLFALPPQPAP    351 - 420
NLEDYHSRNSTLTLEIHAHQEPRKRFTYSQDYLSAMVEPLDLKEEEKKAQKKSRQAWLTARGFQVTGLQS    421 - 490
DTESSFQDLKLPPIKELNEEWKENSLFANVLEPVLDRDRWSWDRHHVDFDLYKKPPPFLELLPSPAPKPV    491 - 560
TVRKKKGNSPIS                                                              561 - 572
//

Text Mined References (1)

PMID Year Title