Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

Synonym

Accession Q6ZU82 A6NMP0
Symbols HEL-182

Gene

 Compartment GO Term (0)

AA Sequence

MREFSLIELWLMPKVFNHYVWGSFLVQRKKKQPKSVLVYHCTSGNLNPCNRGKMGFQVLATFEIPIPFER      1 - 70
ALTRPYADFTTSNFRTQYWNAISQQAPAIIYDFYLWLTGRKPSYRRKIPSSTQFYKWRNRS              71 - 131
//

Text Mined References (5)

PMID Year Title
25085781 2014 LncRNA expression profiles of EGFR exon 19 deletions in lung adenocarcinoma ascertained by using microarray analysis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.