Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.13
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Crohn's disease 304 3.577 1.8
Crohn Disease 97

Expression

Synonym

Accession Q6ZTR7
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (3)

PMID Text
21472827 Genome-wide association studies-reported associations between the NELL1, NCF4, and FAM92B genes and susceptibility to Crohn's disease could not be replicated in Canadian children and young adults.
19262523 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18580884 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNIVFSRDSQVRVMENTVANTEKYFGQFCSLLAAYTRKTARLRDKADQLVKQLIDFANSENPELRATMRG      1 - 70
FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNHEIKQLEKLEKLRQKSPSDQQ     71 - 140
MISQAETRVQRAAVDSSRTTLQLEETVDGFQRQKLKDLQKFFCDFVTIEMVFHAKAVEVYSSAFQTLEKY    141 - 210
DLERDLLDFRAKMQGVYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEW    211 - 280
VVKGQPAHCVCGQGGHLMLPGHSL                                                  281 - 304
//

Text Mined References (7)

PMID Year Title
27528616 2016 BAR Domain-Containing FAM92 Proteins Interact with Chibby1 To Facilitate Ciliogenesis.
21472827 2012 NELL1, NCF4, and FAM92B genes are not major susceptibility genes for Crohn's disease in Canadian children and young adults.
19262523 2009 rs224136 on chromosome 10q21.1 and variants in PHOX2B, NCF4, and FAM92B are not major genetic risk factors for susceptibility to Crohn's disease in the German population.
18580884 2008 Confirmation of association of IRGM and NCF4 with ileal Crohn's disease in a population-based cohort.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.