Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZTR6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRVPPAGTWALRPIWTEMGTPLRGSQAPGRIVLLLLVITPQWRWIPSKTPNVAPRSNQRCNPGGYLSGGV      1 - 70
SLCASHSQPAALPNLGRLQKKLLQTRCKGRRMCPKAGDQTGGAFCMCDVSGGGGECVSGSGGGGESGRKT     71 - 140
GTTSAMKDPRVLKCKLRVTNDLH                                                   141 - 163
//

Text Mined References (2)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.