Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.90
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Asthma 385 4.03 2.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Common cold 69 4.091 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -2.055 4.7e-02
lung adenocarcinoma -1.500 9.0e-05
lung carcinoma 2.200 6.7e-07
nasopharyngeal carcinoma -1.900 1.7e-05
non-small cell lung carcinoma -1.800 1.5e-11
posterior fossa group B ependymoma 2.100 1.2e-05

Gene RIF (3)

AA Sequence

MQEAIILLALLGAMSGGEALHLILLPATGNVAENSPPGTSVHKFSVKLSASLSPVIPGFPQIVNSNPLTE      1 - 70
AFRVNWLSGTYFEVVTTGMEQLDFETGPNIFDLQIYVKDEVGVTDLQVLTVQVTDVNEPPQFQGNLAEGL     71 - 140
HLYIVERANPGFIYQVEAFDPEDTSRNIPLSYFLISPPKSFRMSANGTLFSTTELDFEAGHRSFHLIVEV    141 - 210
RDSGGLKASTELQVNIVNLNDEVPRFTSPTRVYTVLEELSPGTIVANITAEDPDDEGFPSHLLYSITTVS    211 - 280
KYFMINQLTGTIQVAQRIDRDAGELRQNPTISLEVLVKDRPYGGQENRIQITFIVEDVNDNPATCQKFTF    281 - 350
SIMVPERTAKGTLLLDLNKFCFDDDSEAPNNRFNFTMPSGVGSGSRFLQDPAGSGKIVLIGDLDYENPSN    351 - 420
LAAGNKYTVIIQVQDVAPPYYKNNVYVYILTSPENEFPLIFDRPSYVFDVSERRPARTRVGQVRATDKDL    421 - 490
PQSSLLYSISTGGASLQYPNVFWINPKTGELQLVTKVDCETTPIYILRIQATNNEDTSSVTVTVNILEEN    491 - 560
DEKPICTPNSYFLALPVDLKVGTNIQNFKLTCTDLDSSPRSFRYSIGPGNVNNHFTFSPNAGSNVTRLLL    561 - 630
TSRFDYAGGFDKIWDYKLLVYVTDDNLMSDRKKAEALVETGTVTLSIKVIPHPTTIITTTPRPRVTYQVL    631 - 700
RKNVYSPSAWYVPFVITLGSILLLGLLVYLVVLLAKAIHRHCPCKTGKNKEPLTKKGETKTAERDVVVET    701 - 770
IQMNTIFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEE    771 - 840
DELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK                             841 - 885
//

Text Mined References (11)

PMID Year Title