Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.95
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.54120632525624E-11
lung adenocarcinoma 2714 1.97980751336679E-8
lung carcinoma 2844 6.6685067887774E-7
posterior fossa group B ependymoma 1530 1.20270644959045E-5
nasopharyngeal carcinoma 1056 1.67514049429396E-5
chronic rhinosinusitis 512 0.0468416260691924
Disease Target Count Z-score Confidence
Asthma 349 3.738 1.9
Disease Target Count Z-score Confidence
Common cold 63 3.973 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma -2.100 0.000
posterior fossa group B ependymoma 2.100 0.000
nasopharyngeal carcinoma -1.900 0.000
lung carcinoma 2.200 0.000
non-small cell lung carcinoma -1.800 0.000
chronic rhinosinusitis -2.055 0.047

Synonym

Accession Q6ZTQ4 Q8TCI7
Symbols CDH28

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (3)

PMID Text
26270739 CDHR3 is a susceptibility locus for early childhood Asthma with severe exacerbations.
25848009 the asthma susceptibility gene product CDHR3 mediates RV-C entry into host cells, and suggest that rs6967330 mutation could be a risk factor for RV-C wheezing illnesses.
24241537 the role of CDHR3 variants in the development of asthma with severe exacerbations based on genome-wide association study in Denmark

AA Sequence

MQEAIILLALLGAMSGGEALHLILLPATGNVAENSPPGTSVHKFSVKLSASLSPVIPGFPQIVNSNPLTE      1 - 70
AFRVNWLSGTYFEVVTTGMEQLDFETGPNIFDLQIYVKDEVGVTDLQVLTVQVTDVNEPPQFQGNLAEGL     71 - 140
HLYIVERANPGFIYQVEAFDPEDTSRNIPLSYFLISPPKSFRMSANGTLFSTTELDFEAGHRSFHLIVEV    141 - 210
RDSGGLKASTELQVNIVNLNDEVPRFTSPTRVYTVLEELSPGTIVANITAEDPDDEGFPSHLLYSITTVS    211 - 280
KYFMINQLTGTIQVAQRIDRDAGELRQNPTISLEVLVKDRPYGGQENRIQITFIVEDVNDNPATCQKFTF    281 - 350
SIMVPERTAKGTLLLDLNKFCFDDDSEAPNNRFNFTMPSGVGSGSRFLQDPAGSGKIVLIGDLDYENPSN    351 - 420
LAAGNKYTVIIQVQDVAPPYYKNNVYVYILTSPENEFPLIFDRPSYVFDVSERRPARTRVGQVRATDKDL    421 - 490
PQSSLLYSISTGGASLQYPNVFWINPKTGELQLVTKVDCETTPIYILRIQATNNEDTSSVTVTVNILEEN    491 - 560
DEKPICTPNSYFLALPVDLKVGTNIQNFKLTCTDLDSSPRSFRYSIGPGNVNNHFTFSPNAGSNVTRLLL    561 - 630
TSRFDYAGGFDKIWDYKLLVYVTDDNLMSDRKKAEALVETGTVTLSIKVIPHPTTIITTTPRPRVTYQVL    631 - 700
RKNVYSPSAWYVPFVITLGSILLLGLLVYLVVLLAKAIHRHCPCKTGKNKEPLTKKGETKTAERDVVVET    701 - 770
IQMNTIFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEE    771 - 840
DELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK                             841 - 885
//

Text Mined References (11)

PMID Year Title
26270739 2015 Rhinovirus in the Pathogenesis and Clinical Course of Asthma.
25848009 2015 Cadherin-related family member 3, a childhood asthma susceptibility gene product, mediates rhinovirus C binding and replication.
24241537 2014 A genome-wide association study identifies CDHR3 as a susceptibility locus for early childhood asthma with severe exacerbations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20833655 2010 Genome-wide association study identifies genetic determinants of warfarin responsiveness for Japanese.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...